KEGG   Brachyspira pilosicoli B2904: B2904_orf2044Help
Entry
B2904_orf2044     CDS       T02225                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00010  Glycolysis / Gluconeogenesis
bpj00052  Galactose metabolism
bpj01100  Metabolic pathways
bpj01110  Biosynthesis of secondary metabolites
bpj01120  Microbial metabolism in diverse environments
bpj01130  Biosynthesis of antibiotics
Module
bpj_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf2044
   00052 Galactose metabolism
    B2904_orf2044
Enzymes [BR:bpj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     B2904_orf2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFR71373
UniProt: J9UWT0
Position
complement(2088421..2089419)
Genome map
AA seq 332 aa AA seqDB search
MTKEKFGENGFVYTLENKNGLKLKLADVGASITGIFFKNKKGDSIEVAFGSDDVSFYSAK
AKNGHMGATVGRVAGKTLNSSFKIGDKEYKLNPNKAPHHTHGGVDGLSYVFFTSKQIADN
KIEFHYLSKDGEEGYPGNLDLTVTYTLTENNEVIIDYKATTDKPTPANIMNHSYFNLNGK
GKINSHKISIDANYYLPENENGDSSGEILKVDNTPYDFRNMKEIDTIIKSKGGCDNCFVF
DDNDIKKSRVKVVSEESLISLEVFTDMPSVLLYTANSLNNLQVRGQVLNKHEAFCLETQY
FTLALNYNHFPSIILYPDREFKHRTIYKFAAL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaagtttggagagaacggatttgtatatacattagaaaacaagaacggc
ttaaaattaaaactagcagatgttggagcttctataacagggatattttttaaaaataaa
aaaggagatagtattgaagtagctttcggctctgatgatgttagtttttacagtgccaag
gcaaaaaatggtcatatgggtgctactgttggaagggtggctggtaaaactttgaactct
agttttaaaataggagataaagaatataaactaaatccaaacaaagcacctcatcatacg
catggcggagtagatggtctttcttatgtgttttttacttcaaaacaaattgctgataac
aaaatagagtttcattatttatcaaaagacggtgaagaaggataccctggtaatttagat
ttaactgttacatatacacttacagaaaataatgaagttataattgattataaagcaaca
actgataaaccaaccccagcaaacataatgaatcactcttattttaatttgaatggaaag
ggtaaaattaatagtcataaaatatcaatagatgctaattattatttacctgaaaatgaa
aatggagatagttccggagagattttaaaagttgataacactccttatgattttagaaac
atgaaagagattgacactataataaaatctaaaggcggatgcgataactgttttgtattt
gatgataatgatataaaaaaatctagagtaaaagttgtttcagaagagagtttaatatct
ttagaagtgtttacagacatgccttcagttttactatatactgctaattctctaaacaat
ttacaagtgagaggacaagtattaaacaaacatgaggctttttgtttggagacacaatat
tttactttggcactaaattataatcattttccaagtataatactttatccagacagggag
tttaagcatagaaccatttataagtttgctgctttgtga

DBGET integrated database retrieval system