KEGG   Brachyspira pilosicoli B2904: B2904_orf2056Help
Entry
B2904_orf2056     CDS       T02225                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B2904_orf2056 (ruvA)
Enzymes [BR:bpj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B2904_orf2056 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2100904..2101488
Genome map
AA seq 194 aa AA seqDB search
MFAFIEGKVCTISEGIIALLCSNGVAYEIIVSKKLNVNNDDNIRLYTQLIHKEDSMTLYG
FKTREEKKMFNTLMSASGVGAKLAMEVLSTYSIDEIMHILFNKDINMLKKVQGMGIKKAE
KLLFEIRDKIEKIDINISSSKISYNENESDVIKALISLGFSNNEAVKALSNIENKENKTT
EDLISLALRNLSSI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttttatagaaggtaaagtttgcacaatatcagagggaatcattgctctttta
tgttctaatggggtcgcttacgagattatagtatcaaaaaagttaaatgttaataatgat
gataatataagactatacactcaattaatacataaagaagattctatgacgctttatggt
tttaaaacaagagaagagaaaaagatgtttaatactttaatgtctgcctctggtgttggg
gcaaaacttgcaatggaagttctatccacatattcaatagatgaaataatgcatatactc
tttaataaagatattaatatgcttaaaaaagttcagggaatgggcataaaaaaggctgaa
aaacttttgtttgaaattagagataaaatagaaaagatagacataaatatttcttcttct
aaaatatcatataatgaaaatgaaagcgatgtaataaaggctcttatatcattaggcttt
tcaaataatgaagctgtaaaagcattatcaaacatagaaaataaagaaaataaaacaaca
gaagatttaattagcttagcattaagaaatttaagcagcatataa

DBGET integrated database retrieval system