KEGG   Brachyspira pilosicoli B2904: B2904_orf2194Help
Entry
B2904_orf2194     CDS       T02225                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00220  Arginine biosynthesis
bpj00330  Arginine and proline metabolism
bpj01100  Metabolic pathways
bpj01110  Biosynthesis of secondary metabolites
bpj01130  Biosynthesis of antibiotics
bpj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    B2904_orf2194 (rocF)
   00330 Arginine and proline metabolism
    B2904_orf2194 (rocF)
Enzymes [BR:bpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B2904_orf2194 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: AFR71522
UniProt: J9U0V8
Position
2242164..2243030
Genome map
AA seq 288 aa AA seqDB search
MSKTIRLIYPQWQGGIISDWIKELKPEDSSRGYYIGSKLLSILAPQNDNHKTLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILSKNNPDKIITFGGECSVSVVPFTYLNKKYDNDV
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISSILPSRISADKILFVGLRDWE
RDEIKKRQEEYGIPHFAPEEASSENIINWLKKSNASKVLIHFDLDVLDPNEIIAAVGVSP
NGMKINETVRIINDIAKEREIVGFTIAEHMPRIEIMLKNMMEDLDLFK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggtggaattatatctgattgg
ataaaggaattaaagcctgaagattcttcaagaggttattatattgggtcaaaattacta
agcatacttgctcctcaaaatgataatcataaaactttagaagttcctgtttctttagat
ataaaaaatagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgctttagatattttaagcaaaaataatcctgataaaataatcactttcggaggt
gaatgttctgtaagcgtagtgcctttcacatatttaaataaaaaatatgataatgatgtt
gctttaatttggatagatgctcaccctgatattactttgcctgaagataatacttatgcc
ggatatcatgctatggcagttagtgcttgtatgggtaatgttgataaaaatataagctct
atacttccaagcagaatttcagctgataaaatattatttgtagggcttagagattgggaa
agagatgagataaaaaaacgccaagaagaatacggcatacctcattttgctcctgaagaa
gcttcaagcgaaaatataataaattggcttaaaaaatctaatgcttctaaggttttgata
cattttgatttagatgtgcttgaccctaatgaaataatagctgctgtcggcgtttctcca
aatggaatgaagataaacgaaacagtaagaataataaatgatattgccaaagaaagggaa
attgtcggctttactatagcagaacatatgccaagaattgaaataatgcttaaaaatatg
atggaagatttagacttatttaagtaa

DBGET integrated database retrieval system