KEGG   Brachyspira pilosicoli B2904: B2904_orf2194Help
Entry
B2904_orf2194     CDS       T02225                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpj01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242164..2243030
Genome map
AA seq 288 aa AA seqDB search
MSKTIRLIYPQWQGGIISDWIKELKPEDSSRGYYIGSKLLSILAPQNDNHKTLEVPVSLD
IKNREIKNGIMDYDFIVSQTKNALDILSKNNPDKIITFGGECSVSVVPFTYLNKKYDNDV
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKNISSILPSRISADKILFVGLRDWE
RDEIKKRQEEYGIPHFAPEEASSENIINWLKKSNASKVLIHFDLDVLDPNEIIAAVGVSP
NGMKINETVRIINDIAKEREIVGFTIAEHMPRIEIMLKNMMEDLDLFK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattgatttatccgcagtggcagggtggaattatatctgattgg
ataaaggaattaaagcctgaagattcttcaagaggttattatattgggtcaaaattacta
agcatacttgctcctcaaaatgataatcataaaactttagaagttcctgtttctttagat
ataaaaaatagagaaataaaaaatggtattatggattatgattttatagtatctcaaact
aaaaatgctttagatattttaagcaaaaataatcctgataaaataatcactttcggaggt
gaatgttctgtaagcgtagtgcctttcacatatttaaataaaaaatatgataatgatgtt
gctttaatttggatagatgctcaccctgatattactttgcctgaagataatacttatgcc
ggatatcatgctatggcagttagtgcttgtatgggtaatgttgataaaaatataagctct
atacttccaagcagaatttcagctgataaaatattatttgtagggcttagagattgggaa
agagatgagataaaaaaacgccaagaagaatacggcatacctcattttgctcctgaagaa
gcttcaagcgaaaatataataaattggcttaaaaaatctaatgcttctaaggttttgata
cattttgatttagatgtgcttgaccctaatgaaataatagctgctgtcggcgtttctcca
aatggaatgaagataaacgaaacagtaagaataataaatgatattgccaaagaaagggaa
attgtcggctttactatagcagaacatatgccaagaattgaaataatgcttaaaaatatg
atggaagatttagacttatttaagtaa

DBGET integrated database retrieval system