KEGG   Brachyspira pilosicoli B2904: B2904_orf2245Help
Entry
B2904_orf2245     CDS       T02225                                 

Definition
(GenBank) aldehyde alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00010  Glycolysis / Gluconeogenesis
bpj00071  Fatty acid degradation
bpj00350  Tyrosine metabolism
bpj00620  Pyruvate metabolism
bpj00625  Chloroalkane and chloroalkene degradation
bpj00626  Naphthalene degradation
bpj00650  Butanoate metabolism
bpj01100  Metabolic pathways
bpj01110  Biosynthesis of secondary metabolites
bpj01120  Microbial metabolism in diverse environments
bpj01130  Biosynthesis of antibiotics
bpj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf2245
   00620 Pyruvate metabolism
    B2904_orf2245
   00650 Butanoate metabolism
    B2904_orf2245
  Lipid metabolism
   00071 Fatty acid degradation
    B2904_orf2245
  Amino acid metabolism
   00350 Tyrosine metabolism
    B2904_orf2245
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B2904_orf2245
   00626 Naphthalene degradation
    B2904_orf2245
Enzymes [BR:bpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B2904_orf2245
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B2904_orf2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFR71573
UniProt: J9UXG2
Position
complement(2301403..2304006)
Genome map
AA seq 867 aa AA seqDB search
MTKDTKAKSGNSVLDDLISKAKKAQEIYSTFSQEQVDAIFKACAIAINSRRIPLAKMAVE
ETGMGVVEDKVIKNHFASEYIYNKFKDMKTCGIISEDTAMGMKKIAEPVGIIAGVVPTTN
PTSTAAFKALIALKTRNAIVFSPHPRAKKCTLEVCNIINKVAVEHGAPDGLVGCIEEPTV
ELSAALMSHPQIDLILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDETADIKMAVNSVI
MSKTFDNGMICASEQTVVVVKSVYEEVKKEFLYRGAYLLNKDEKAKLSKVMIIDGALNAK
IVGQPAYVIAKMAGITVPEETKILIGEASSISKDEAFSYEKLSPVLGMYKADNYDDAVEK
AHSLIVFGGLGHTSVLYTDEDNQKERIKKFYEKMPTGRILINMPSSQGAIGDVYNFRLEP
SLTLGCGSWGNNSTSENVGPKHLLNIKSVASRRENMLWYRVPEKIYLKRGSLDVALREYA
NKKRALIITDGPLFKLGVTDNVTKVLDDIGVKYTIFSDVKPDPTISTVRDIVKTANVFEP
DVIIALGGGSPIDAGKIAWLLYENPEVKFEDIAMVFMDIRKRICDAGELGKKAQFVAIPT
TSGTGSETTPFAVITDDATHIKYPITDYALTPDMAILDANLVMSMPKGLCAASGIDSLTH
ALEAYASICSTEFSNSNAEKAIKLIFKYLPASYKEGAENPVAREQMHYAASLAGMAFANA
FLGICHSLAHKLGAAFNIPHGIANALLICQVVKYNSNEKPTKQGLFPQYKYPHARERYAF
IADMLGLGCKNDNEKVANLIKAINGLKKDLDIPLSIKDYGVAEKDFMAKLDDIVEQAFND
QCTGANPVYPLMKELKQIYLDAYNGVY
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagatacaaaagcaaaaagcggaaattctgtactagatgacttaatatcaaaa
gcgaaaaaagcacaagaaatatattctactttttctcaagaacaagtagatgccatattt
aaagcatgtgctattgctattaacagcagaagaatacctttagcaaagatggctgtagaa
gaaacaggtatgggagtagtagaagataaagtaataaaaaatcactttgcttctgaatat
atttataacaagtttaaagatatgaagacatgcggaatcataagtgaagatactgctatg
ggaatgaaaaaaatagcagaacctgttggtataatagctggtgttgtacctactacaaac
ccaacatcaactgctgcattcaaagcattaatagctttaaaaacaagaaatgcaatagta
ttttctccgcatccaagagctaagaaatgtactcttgaagtttgtaatattattaacaaa
gtagctgttgagcatggggcacctgatggacttgttggctgtattgaagagcctacagtt
gagctttctgctgctttaatgagccatcctcaaattgatttaatacttgctactggagga
cctggaatggttaaggctgcttattctagcggtaaacctgctttaggtgttggtgctggt
aatacccctgctataatagatgaaactgctgatataaaaatggctgttaattctgttata
atgagtaaaacttttgacaatggtatgatatgtgctagtgaacagactgttgttgttgta
aaaagtgtttatgaggaagtaaaaaaagaattcctatacagaggagcttatcttttaaat
aaagatgaaaaagctaaacttagcaaagtaatgattatagacggtgctttgaatgctaag
atagtaggtcagcctgcttatgtgatagctaaaatggctggaattactgttccagaagag
acaaaaatacttataggtgaagcttcttctataagcaaagatgaagcattctcttacgaa
aaattatcacctgtacttggtatgtataaggctgataattatgatgatgctgttgagaaa
gctcatagtttaatagtatttggaggacttggacacacttctgtactttatacagatgaa
gataatcaaaaagaaagaattaaaaaattctacgaaaaaatgcctacaggaagaatactt
ataaatatgccgtcttctcaaggtgctataggagatgtatataactttagattagaacca
tctttgacattaggctgcggaagctggggcaacaactctacaagtgaaaacgttggtcct
aaacatcttttaaatattaaatctgtagcttcaaggagagaaaatatgttatggtataga
gtaccagaaaagatatatttaaaaagaggttcattagatgttgctttaagagaatatgct
aacaaaaaaagagcattaatcatcacagacggaccgcttttcaaattaggtgtaactgac
aatgttactaaagtattagatgatataggagtaaaatatactatattctctgatgttaag
cctgatcctacaattagtactgttagagatatagtaaaaacggctaatgtatttgaacct
gatgttattatagcattaggaggcggttctccaatagatgctggtaagattgcttggctt
ctttatgaaaaccctgaagtaaaattcgaagacattgctatggtatttatggatataaga
aagagaatatgtgatgctggtgaattaggtaaaaaggctcagtttgttgctatacctact
acttctggtactggttctgaaactactccttttgctgttattactgatgatgctacacat
attaaatatcctattacagattatgctttaactcctgatatggctatacttgatgctaat
ttggttatgagtatgccaaaaggtttatgtgctgcaagcggtatagactctttaactcat
gctcttgaggcttatgcttctatatgttctactgagttttctaattctaatgctgaaaaa
gctattaaattaatatttaaatatttgcctgcttcatataaagaaggtgctgaaaaccct
gtagctcgtgaacaaatgcattatgctgcttcacttgctggtatggcttttgctaatgct
ttcttgggtatttgtcactcattggctcataaacttggggctgctttcaatattcctcat
ggtattgctaatgctcttttaatatgtcaggttgttaaatataattctaatgaaaaacct
actaaacaaggtttattccctcaatataaatatcctcatgctagagagagatatgcattt
attgctgatatgcttggtcttggctgcaaaaatgataatgaaaaagtagctaatttaatt
aaggctatcaatggtcttaagaaagatttggatatacctttgtctattaaagattatggt
gtagctgaaaaagactttatggctaaacttgatgatatagtagaacaggcatttaatgat
caatgtactggtgctaatccggtttatcctcttatgaaagaattaaaacaaatttattta
gatgcttataatggtgtttattaa

DBGET integrated database retrieval system