KEGG   Brachyspira pilosicoli B2904: B2904_orf2397Help
Entry
B2904_orf2397     CDS       T02225                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B2904_orf2397
Enzymes [BR:bpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B2904_orf2397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2462856..2463725
Genome map
AA seq 289 aa AA seqDB search
MSKSILVIGSINKDLVVNTLRFPKEGETILGNNFYTTNGGKGANQACAIGKLGGNVAMLG
AIGNDNFGKDLSNALYSNNVNIDNLLMKNDVSTGIAVITVTNDGANHIIVAQGANALITK
DDIKEKLIASFDIIVMQLEIPLEIVKYAASIAKKLSKTVVLNPSPAVKLDKDFLSCVDIL
IPNETEIDIIGGVDYVLECGVKNIILTLGADGCELITKQNRKHFDAYKVNVVDTTAAGDS
FLGGVVRMIADDKTIEEAIEFATKVSNITVTRKGAIDSIPTYNEVIDNY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaagtattttagtaataggaagtataaataaagatttagttgttaatactttg
cgtttccctaaagaaggcgaaactatacttggcaacaatttttatactactaatgggggt
aagggggcaaatcaggcatgtgccataggtaaattgggtggaaatgtagctatgcttggt
gctattggaaatgataattttggtaaagatttatcaaatgctttatattctaataatgtt
aatatagataatttattaatgaaaaatgatgtttctacaggcatagctgttattacagtt
actaatgatggagctaatcatattattgtagcacaaggagctaatgctttaattacaaaa
gatgatatcaaagaaaaattaattgcatcatttgatataatagttatgcagttggagata
cctttagaaatagtaaagtatgctgcatctattgctaaaaaacttagtaaaactgttgtg
ttaaatccttcccctgctgtaaaactagataaagattttttaagctgtgtagatatacta
attccaaatgaaacagaaatagatattataggcggtgttgattatgtgcttgaatgcgga
gttaaaaatataatacttactttaggtgctgatggatgcgagcttataacaaaacaaaat
agaaaacattttgatgcatataaagttaatgttgttgatactactgctgcaggagacagt
tttttaggcggagttgtaagaatgattgctgatgataaaactattgaagaggctattgaa
tttgctactaaagtttctaatataactgttactagaaaaggagcaatagattctatacct
acatataatgaagtaattgataactattaa

DBGET integrated database retrieval system