KEGG   Brachyspira pilosicoli B2904: B2904_orf318Help
Entry
B2904_orf318      CDS       T02225                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306936..308396
Genome map
AA seq 486 aa AA seqDB search
MCRFPDNFLWGGAIAANQAEGAWNVDGKGMSVADVSMYKPKVDVKDYSTQWHVGIEDIEK
AMKTDDTVYYPKRRGIDFYHRYKEDMALFAEMGFKTLRVSIAWSRIFPNGDEKEPNELGL
KFYEDLFKEMRKYNIEPLVTLSHYEMPLYLVNKYDGWVSREVVDMFVNFSKVCFNRYKDL
VKYWLTFNEIDSIFRHPFITAGIVEDKYKSKKEAEGIIYQALHHQFVASALAVKYAHKII
KDSKVGCMITKLLTYPETCNPLDIYLAQSDNRNNMFYSDVQVFGEYPKYVLNYLKRNNFD
IVFKEGDEAILKQYTVDFVSFSYYMSIVQSIDADKREKVGGNVATGVKNKYLQTSDWGWQ
IDPIGLKVALIDLYDRYRLPLFIVENGLGAFDKIEPDGSINDDYRIEYLKEHLKQVALAI
EEGVECMGYTSWGCIDIISAATSQMSKRYGFIYVDCDDLGNGTFNRTKKKSFYWYKDVIS
SNGSNL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagatttccagataattttttatggggcggagctatagctgcaaatcaggctgag
ggtgcttggaatgttgatggtaagggtatgtcggtagctgatgtttctatgtataagcct
aaggtggatgtaaaagattattcaactcaatggcatgttggtattgaagatatcgaaaaa
gctatgaaaactgatgatacagtatattatccaaagagaaggggtattgatttttatcat
agatataaagaagatatggcattatttgctgagatgggatttaaaactttaagagtatct
attgcttggagcagaatatttcctaatggtgatgaaaaagagcctaatgagcttggatta
aaattttatgaagatttatttaaagagatgagaaaatataatatagagccattagttact
ttatcgcattatgagatgcctttatatttggttaataaatatgacggctgggtttcaaga
gaagttgttgatatgtttgtaaattttagcaaggtttgttttaacagatataaggatttg
gtaaagtattggcttacattcaatgaaatagacagtatattcagacatccatttattaca
gctggtatagtagaagataaatataaaagtaaaaaggaagcagaaggtattatataccaa
gcattacatcatcaatttgttgcaagtgctttggctgttaaatatgctcataaaatcata
aaagattctaaagtaggctgcatgattacaaaactattaacatatcctgaaacatgcaat
cctttggatatttatttggcacaaagcgataatagaaataatatgttttacagtgatgtt
caagtttttggagagtatcctaaatatgttttaaattatttaaaaaggaataattttgat
atagtatttaaagaaggcgatgaggctattttaaaacaatacacagtagattttgtttct
tttagttattatatgtctatagtgcaaagtatagatgctgataaaagagagaaggttgga
ggaaatgttgctacaggtgtaaaaaataaatatctacagactagcgactggggctggcag
atagatcctataggtttgaaagttgctttaatagatttatatgacagatatcgtttgcct
ctttttatagttgaaaatggacttggagctttcgataagatagagcctgatggaagtata
aatgatgattatagaatagaatatttaaaagagcatctaaaacaggttgctttggcaata
gaagagggtgttgaatgtatgggttatacttcttggggctgtattgatattataagtgct
gctacttcacaaatgtctaagagatacggatttatatatgttgattgtgatgatttaggt
aatggtacatttaatagaactaagaaaaaatctttttattggtacaaagatgttatatcc
tctaatggttcaaatttataa

DBGET integrated database retrieval system