KEGG   Brachyspira pilosicoli B2904: B2904_orf428Help
Entry
B2904_orf428      CDS       T02225                                 

Definition
pyruvate oxireductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpj00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpj00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpj00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpj00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpj00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:bpj00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408907..409938
Genome map
AA seq 343 aa AA seqDB search
MKLPKVNDLGFFEIRLESIGGMGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKS
FVRFSETEVRVNSTVEEPHVVAVFHMNLLKNPLTLAGVKEDAIVIFNTNKTPDEARDFAK
LHGGKVVCIDAIKIANDLKLPSQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFGGRKAEL
VEPNIEAFRKGGSESVVKEFKADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDL
QVTRTGNIPVFNPANCIDCANCEVVCPDLCIVWEKGPDRKDPNKTAMNMMGIDYQYCKGC
LKCVRACPKGPYSGKFEKDQQALRIEVEANCDVDKLTYRRYKK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcccaaaagtcaatgatttaggatttttcgagatccgtctcgaaagtatcggt
ggaatgggtgctaatagtgctggtaaaatgcttgcagaagtaggcgttttaacacaaggt
ttctatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagtaaaatct
tttgtaaggttttcagaaactgaagttagagtaaactctactgtagaagaaccacatgta
gtggcagtgttccacatgaatcttctaaaaaaccctcttacattagctggtgttaaagaa
gatgctattgttatttttaacactaataaaacacctgatgaggcaagagattttgctaaa
ttacatggcggtaaagtagtttgtattgatgcaataaaaatcgctaatgatttaaaactt
ccttcacaagctgctaatactatcataatgggtgctatggttaatcagcttgatttcata
gattctgctaagtttgaagagcaaatcagaaaacaattcggcggaagaaaagctgaatta
gttgagccaaatattgaagctttcagaaaaggcggaagtgaatctgttgttaaagaattc
aaagctgacggaaaatatccttatattccttataaaaaaccagaacctgtatatggtaaa
aataaccaattaacaggcggttatatcaatgctgctggtaactctactttaaaagattta
caagttactcgtactggtaatatacctgtattcaatcctgctaactgtattgattgtgct
aactgtgaagttgtttgtcctgacctttgtatcgtttgggaaaaaggaccagacaggaaa
gaccctaataaaactgctatgaatatgatgggtatagattatcaatactgtaaaggttgt
ttaaaatgtgttagagcttgccctaaaggaccttattctggtaaatttgaaaaagatcag
caggctttaagaatagaagtagaagctaattgtgatgttgataaacttacatacagacgt
tataaaaaataa

DBGET integrated database retrieval system