KEGG   Brachyspira pilosicoli B2904: B2904_orf467Help
Entry
B2904_orf467      CDS       T02225                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2904_orf467 (pfkA)
   01230 Biosynthesis of amino acids
    B2904_orf467 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf467 (pfkA)
   00030 Pentose phosphate pathway
    B2904_orf467 (pfkA)
   00051 Fructose and mannose metabolism
    B2904_orf467 (pfkA)
   00052 Galactose metabolism
    B2904_orf467 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    B2904_orf467 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    B2904_orf467 (pfkA)
Enzymes [BR:bpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B2904_orf467 (pfkA)
Protein phosphatases and associated proteins [BR:bpj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B2904_orf467 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448261..449241
Genome map
AA seq 326 aa AA seqDB search
MADIKKIGVLTSGGDASGMNPTIRSVVRTAIANGLEVVGIREGYQGLMYNNVYKMDAGSV
GGIINHGGTILFSARSPEFQTEEGMKKAADNMKYNGIDALVVIGGDGTYKGALDFANHHE
EFPVIGIPGTIDNDIFGTDYTIGYDTAVNVAMEAIDKLRDTATSHGRCFVVEVMGRHAGY
IALEVGIASGAEDILIPETTTDIDKIVENLQIAKKRGKKSSIIVVAEGDESGGAMEVAKQ
IEGKTGFDTRVTILGHMQRGGSPTSRERLMAARFGYIAVKALLEGKRNVAVGIWKGEYTY
TPLADAVKKVPKVDPIDLELCRTLAI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaagaaaataggagtattaacaagcggaggagatgcttcaggaatgaac
cctactataagaagcgttgttagaacagctatagctaatggtttagaggtagttggaata
agagaggggtatcagggtttaatgtataataatgtttataaaatggatgctggttctgtt
ggcggcattattaatcatggcggtacaattttgttttctgcaaggtctccagagtttcaa
actgaagaaggaatgaaaaaagcagctgataatatgaaatataacggaatagatgctttg
gttgttataggcggtgatggtacttataaaggagcattagattttgctaatcatcatgaa
gagtttcctgttattggtatacctggtactatagataatgatatatttggtactgattat
actataggatatgatacagctgtaaacgttgcaatggaggctatagacaaattaagagat
actgctactagccacggaagatgttttgtagttgaggttatgggaagacatgctggttat
attgccttagaagttggtatagcttctggtgctgaagacatacttattccagaaactact
actgatattgacaaaatagtagaaaacttacaaatagcaaaaaagagaggtaaaaaatct
tctataatagtggttgctgagggagatgagtctggcggagctatggaggtagctaaacaa
atagaaggtaaaactggttttgatactcgtgttactatacttggacacatgcaaagaggc
ggttctcctacttctcgtgaacgtcttatggctgcaagatttggttatattgcagttaag
gcattattagaaggtaagagaaatgttgctgttggtatatggaaaggtgaatatacttac
actcctttagctgatgctgttaaaaaagttcctaaagttgatcctatagatttagagttg
tgcagaactcttgctatataa

DBGET integrated database retrieval system