KEGG   Brachyspira pilosicoli B2904: B2904_orf467Help
Entry
B2904_orf467      CDS       T02225                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
bpj00010  Glycolysis / Gluconeogenesis
bpj00030  Pentose phosphate pathway
bpj00051  Fructose and mannose metabolism
bpj00052  Galactose metabolism
bpj00680  Methane metabolism
bpj01100  Metabolic pathways
bpj01110  Biosynthesis of secondary metabolites
bpj01120  Microbial metabolism in diverse environments
bpj01130  Biosynthesis of antibiotics
bpj01200  Carbon metabolism
bpj01230  Biosynthesis of amino acids
bpj03018  RNA degradation
Module
bpj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf467 (pfkA)
   00030 Pentose phosphate pathway
    B2904_orf467 (pfkA)
   00051 Fructose and mannose metabolism
    B2904_orf467 (pfkA)
   00052 Galactose metabolism
    B2904_orf467 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    B2904_orf467 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    B2904_orf467 (pfkA)
Enzymes [BR:bpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B2904_orf467 (pfkA)
Protein phosphatases and associated proteins [BR:bpj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B2904_orf467 (pfkA)
Messenger RNA biogenesis [BR:bpj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B2904_orf467 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat AP_endonuc_2 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AFR69816
UniProt: J9UBH8
Position
448261..449241
Genome map
AA seq 326 aa AA seqDB search
MADIKKIGVLTSGGDASGMNPTIRSVVRTAIANGLEVVGIREGYQGLMYNNVYKMDAGSV
GGIINHGGTILFSARSPEFQTEEGMKKAADNMKYNGIDALVVIGGDGTYKGALDFANHHE
EFPVIGIPGTIDNDIFGTDYTIGYDTAVNVAMEAIDKLRDTATSHGRCFVVEVMGRHAGY
IALEVGIASGAEDILIPETTTDIDKIVENLQIAKKRGKKSSIIVVAEGDESGGAMEVAKQ
IEGKTGFDTRVTILGHMQRGGSPTSRERLMAARFGYIAVKALLEGKRNVAVGIWKGEYTY
TPLADAVKKVPKVDPIDLELCRTLAI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgatataaagaaaataggagtattaacaagcggaggagatgcttcaggaatgaac
cctactataagaagcgttgttagaacagctatagctaatggtttagaggtagttggaata
agagaggggtatcagggtttaatgtataataatgtttataaaatggatgctggttctgtt
ggcggcattattaatcatggcggtacaattttgttttctgcaaggtctccagagtttcaa
actgaagaaggaatgaaaaaagcagctgataatatgaaatataacggaatagatgctttg
gttgttataggcggtgatggtacttataaaggagcattagattttgctaatcatcatgaa
gagtttcctgttattggtatacctggtactatagataatgatatatttggtactgattat
actataggatatgatacagctgtaaacgttgcaatggaggctatagacaaattaagagat
actgctactagccacggaagatgttttgtagttgaggttatgggaagacatgctggttat
attgccttagaagttggtatagcttctggtgctgaagacatacttattccagaaactact
actgatattgacaaaatagtagaaaacttacaaatagcaaaaaagagaggtaaaaaatct
tctataatagtggttgctgagggagatgagtctggcggagctatggaggtagctaaacaa
atagaaggtaaaactggttttgatactcgtgttactatacttggacacatgcaaagaggc
ggttctcctacttctcgtgaacgtcttatggctgcaagatttggttatattgcagttaag
gcattattagaaggtaagagaaatgttgctgttggtatatggaaaggtgaatatacttac
actcctttagctgatgctgttaaaaaagttcctaaagttgatcctatagatttagagttg
tgcagaactcttgctatataa

DBGET integrated database retrieval system