KEGG   Brachyspira pilosicoli B2904: B2904_orf497Help
Entry
B2904_orf497      CDS       T02225                                 

Definition
fructose-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B2904_orf497
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B2904_orf497
   00030 Pentose phosphate pathway
    B2904_orf497
   00051 Fructose and mannose metabolism
    B2904_orf497
  Energy metabolism
   00680 Methane metabolism
    B2904_orf497
Enzymes [BR:bpj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     B2904_orf497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479000..480943
Genome map
AA seq 647 aa AA seqDB search
MKDKDYLELLSQKYPTIDDASVEIINLKAICKLPKGTEYFLSDIHGESEGFEYLIGTSSG
VIKEKIEILFRNTLTENERIELQILIVDTKNMINKKASKEDFNDWCRITIYRLIRICKLV
TSKYTRSKIRKKMPQNFAYILDELLQTSVEDNKENYYFSIIDSIIDVSASEKFIMALCAL
IRKCSIDRLHIVGDIYDRGPHPDKVIESIMNFNEVDMAWGNHDIHWLGAAKGSLICVANA
VRLAVRYNNFDLLEYSYGINLRALSSFANEVYKDDPCEVFKPNTLDKNIYDEVDKDLASK
MHKAISIIQFKLECQLIKRHPNYAMDERILLDKIDYKKGTINIDGKTYELKDKNFPTINP
KNPFELTEGENTLIQSLAFSFINSPTLQKHTNYIYAKGGIYKIFNGNLLYHGCIPTKEDG
SFDDVYIDGQYLSGKRYLKQVEDKVRKAFYCEVGSEEQLNALDYCWYLWCGPKSPLFGKN
KMTTFERYFIEDKETHKESYNSYYYHIDKKDYCESILKEFDLDIHKSHIVNGHVPVKTHK
GESPIKGGGILLVIDGGLSKAYHKSTGIGGYTLISNSNAMIIAEHRPFAEVVESGFRISP
KTTIVDRFVTRITVGETDIGIGLNKRISDLEELLNAYRNGIVKEKVN
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaggattatttagagttattatctcaaaagtaccccactatagacgatgct
tctgttgaaattattaatttaaaagctatatgcaaattgccaaagggtactgaatatttt
ttaagcgatatacatggagaatctgaaggctttgaatatttaataggcacttcatctggt
gttataaaagagaaaatagaaatattatttagaaatactttaacagaaaatgagagaata
gaacttcaaatacttatagtagatacaaagaacatgattaataaaaaagcatctaaagaa
gattttaatgattggtgcagaataactatatacagacttattagaatatgcaagcttgtt
actagcaaatatacaaggtcaaagattagaaagaagatgcctcagaactttgcttatata
cttgatgaacttttacaaacatctgttgaagacaataaagagaattattatttttctata
atagattctataatagatgtgtctgcatcagaaaagtttattatggcattatgtgctttg
ataagaaaatgcagtatagacaggcttcatattgtaggcgatatttatgacagaggacct
cacccagataaggtaattgagagtataatgaactttaatgaagttgacatggcttggggc
aatcatgatatacattggcttggtgctgctaagggtagtttaatttgcgttgctaatgct
gttcgtttggctgtgagatataataattttgatttgcttgaatatagttatggcataaat
ttaagggctttatcatcatttgctaatgaggtttataaagatgacccttgcgaagtgttt
aaacctaatactctagataaaaatatatatgatgaggttgataaagatttagcttcaaag
atgcataaggctatatcaataatacaatttaagttggaatgtcagcttataaaaagacac
ccaaattatgctatggacgaacgtatacttcttgataagattgattataaaaaaggcact
attaatattgacggtaaaacctatgagcttaaagataaaaactttccaacaataaatcct
aaaaatccttttgagcttacagaaggagaaaatactttaatacagagtttagctttttct
tttatcaatagcccaacacttcaaaagcatactaattatatttatgctaaaggcggaata
tataaaatatttaatggaaaccttctttatcatggatgcatacctacaaaagaagacggc
agttttgatgatgtatatatagacggacaatatttatctggaaagagatatttaaagcaa
gttgaagacaaggtacgtaaggcattttactgcgaagttggaagcgaagaacagcttaat
gctttggattattgctggtatttatggtgcggtccaaaatctccattattcggtaaaaat
aaaatgacaacctttgaaagatattttatagaagataaagaaactcataaagaaagttat
aattcatattattatcatatagacaaaaaagattattgcgagagcatattaaaagagttt
gatttggatatacataaatcacatatagttaatgggcatgtacctgtaaagactcataaa
ggtgaaagcccaattaaaggcggtggaatacttttagtaatagacggaggactttctaag
gcctatcataaaagcacaggcataggaggctacactttaatatcaaactctaatgccatg
attatagcagagcatagaccttttgctgaagtagtggaatctggttttagaatatctcca
aaaacaactatagtagatagatttgtaactagaattacagtaggtgaaactgatattggt
attggcttaaacaaaagaataagtgatttggaagaattactcaatgcatatagaaacggt
atagtaaaagagaaggtgaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system