KEGG   Brachyspira pilosicoli B2904: B2904_orf57Help
Entry
B2904_orf57       CDS       T02225                                 

Definition
UDP-N-acetylglucosamine 1 carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B2904_orf57
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B2904_orf57
Enzymes [BR:bpj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     B2904_orf57
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63058..64335)
Genome map
AA seq 425 aa AA seqDB search
MYKYTIEGSKNINGTVKISGSKNASLPLLVASILTDEPVTLHNVPDLVDVQVLINILEPL
GKKVDFKNNTTVIISQNGKSDEAPYKLVKKMRGSIIVLGPLLAKRKHCKVSYPGGCAFGP
RPIDLHLKGMEALGAKIDITAGYIDATVKDNLIGADINLSGKNGPTVLGTDNVMMAATLA
KGTTIIRNAAREPECTNLAELLKAMGAKIEGIGTSTLTIEGVENLKGVEFEVIPDRIETG
TFLAMAAAGRGKLKLENTNPEHLTYVLDLLSSIGCDIKTTKSTIEIDASNKELKPFEIET
LPYPGFPTDLQAIFTTLACTIKGSSKIKETIYPDRFSNVPELIRMGADIELFEPSIIVNG
GNKLSGADVQASDLRAGAALVIAGAVADGVTDLHRIYHIERGYEDFVNKLNKINIKTTKE
KDDIL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatacactatagaaggctctaaaaatattaatggaactgtaaaaatttccggt
tctaaaaatgcatcacttcctcttttggtagcttcaatacttaccgatgaacctgtaaca
cttcataatgtaccagatttagttgatgtgcaggtattaataaacatattagaaccattg
ggaaagaaagttgattttaaaaacaacaccactgtgataatatctcaaaacggcaaaagc
gatgaagctccatataaactagtaaaaaaaatgagaggctctattatagtgcttggacca
ttacttgcaaaacgcaagcattgtaaggtttcctaccccggcggctgtgcttttggtcca
agaccaatagatttgcatctgaaaggaatggaagcattaggtgctaagattgatatcacc
gccggctatatagacgccactgtaaaagataatctaataggtgcagatataaacttatct
ggaaaaaatggccctactgttttgggtactgataatgttatgatggctgctactttggct
aaaggtacaactattataagaaatgccgcaagagagccagaatgtacaaacctagcagaa
ttattaaaagctatgggggcaaaaattgaaggcataggaacttctacgctcacaatagaa
ggtgttgaaaacttaaaaggcgtagagtttgaggtgataccagacagaatagaaacaggt
acttttttggcgatggctgctgctggaagaggaaaattaaaattagaaaatactaatcca
gaacatttaacttatgtgttagatttgctttcttctataggctgcgatataaaaactaca
aaatcaactatagaaatagatgcttcaaataaagaattaaagccttttgaaatagaaact
cttccatatccaggctttccaacagatttgcaggcaatatttacaactttagcatgcaca
ataaaaggttcaagcaagataaaagagactatttacccagacagattcagcaatgtacca
gaattaattcgtatgggtgctgatatagaattatttgaacctagcattattgtaaatggc
ggaaataaactttctggtgctgatgtacaggctagtgatttgcgtgccggtgctgcattg
gttattgctggtgctgtagcagacggtgttacagaccttcacagaatataccacatagaa
agaggatacgaagactttgtaaataaattaaacaaaattaatataaaaacaacaaaagaa
aaagatgatatattataa

DBGET integrated database retrieval system