KEGG   Brachyspira pilosicoli B2904: B2904_orf738Help
Entry
B2904_orf738      CDS       T02225                                 

Gene name
bglX
Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpj  Brachyspira pilosicoli B2904
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B2904_orf738 (bglX)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    B2904_orf738 (bglX)
Enzymes [BR:bpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     B2904_orf738 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747684..748622
Genome map
AA seq 312 aa AA seqDB search
MSNYIDEVNSMSIEERRGLLTMVGITDTVLSKETIKTLKDNHVSGVILFNYNIVDEEQLK
KLTSDLKKYVNKNMLISIDEEGGEVFRIPFDKYKDISAKMIGDSNSIEYAYNIAYNKAKF
LKDMGINMILGPLCDVPSNKDSYIYNRSFSTNVEMVSKMVEATIKAQKDAGIISVVKHFP
GHGDTAVNSHSEFPVIDKTLEELKNKELIPFQKAIDLGVEMVLVSHIKNKYIDDTLPASM
SEKYRKLLEEDMGFKGVIITDDLVMTGKIESTINYGINLTSNIYKNVKEMFRNIEPDIIS
CAKVLKIMRENT
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaactatatagatgaagttaatagtatgagcattgaagagaggagagggcttctt
actatggtgggcatcactgacacagtattaagcaaagagaccataaagacattaaaagat
aatcatgtttctggagttatactttttaattacaacatagtagacgaagagcaattaaag
aaattgacttcagacttaaagaaatatgttaacaaaaatatgttaatttctatagacgaa
gaaggaggcgaagtctttagaatacctttcgacaaatacaaagacatttcagccaaaatg
ataggcgacagcaacagcatagaatatgcatacaacatagcatataacaaagcaaagttt
ctaaaagatatgggtattaatatgatacttggtccgttatgcgatgtgccaagcaacaaa
gattcttatatatacaatagaagtttttctacaaatgttgagatggtttcaaagatggtg
gaagctacaataaaagctcagaaagatgccggtattataagcgttgttaagcattttcct
ggtcatggggacactgctgttaattcgcatagtgagtttcctgtgatagataaaacttta
gaagagcttaaaaataaagaattaataccttttcaaaaggctatagatttgggtgttgag
atggttttagtttcgcatataaaaaataaatatatagatgatacacttcctgctagcatg
tcagaaaagtatagaaagttacttgaggaagatatgggttttaaaggggtgattattaca
gatgacctcgttatgacaggaaagattgagagcactatcaattacggcataaatcttaca
agcaatatttataagaatgtaaaagagatgtttagaaatatagaaccagatataatttca
tgtgctaaggtattaaagataatgagagaaaatacctaa

DBGET integrated database retrieval system