KEGG   Burkholderia pseudomallei NCTC 13179: BBK_119Help
Entry
BBK_119           CDS       T02894                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBK_119 (glgB)
Enzymes [BR:bpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BBK_119 (glgB)
Exosome [BR:bpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBK_119 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:164106..166322
Genome map
AA seq 738 aa AA seqDB search
MTDAPFDRADIDALLGARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQIDPAGCFAGALPDGQERGERPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARASLDLAHAPVSIYEVHPESWLRVAAEGNRSATWDELAQRLIPYAAGMGFSHVELTP
IAEYPFGGSWGYQSLSPFAPSARFGPPEGFARFVEHAHAAGLGVIVDWVPAHFPDDPHGL
GKFDGTALFEHADPREGWHPDWHTHVFNVGRREVGAFLIASALAWAHRYHVDGIRVDAVA
SMLYRDYSRAAGEWVPNVYGGRENLESIAFLKHFNDTLHGPAAPPGVATFAEESTAWPGV
TAPTAEHGLGFDFKWNMGWMHDTLAYLREDPIHRRHHHDRLTFGLVYAFSERFVLPLSHD
EVVHGKGSLAAKMPGDAWQRLANLRAYFGFMWAHPGKKLLFMGGEFAQWGEFAHDATPQW
DLLDAPAHRGVQRLVRDLNRLHAAEPALHALDDRPAGFAWLVGDDRNNSVFAFVRRDDAG
RMLVAVCNFTPVPRTDYRLGLPAPGRWAEVLNTDGAAYGGTDAGNGGAVQADEIPAHGER
WSAALRLPPLATLWLRPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcggcgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcagatcgatccggccggctgcttcgccggcgcgctgcccgatgggcaggaacgcggc
gagcggccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgttgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccat
ccggaatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctc
gcgcagcggctgattccgtatgcggccggcatgggcttctcgcacgtcgagctcacgccg
atcgccgagtatccgttcggcggctcgtggggctaccagtcgctatcgccgttcgcgccg
tccgcgcggttcgggccgccggaaggcttcgcgcgcttcgtcgagcacgcgcacgcggcc
ggcctcggcgtgatcgtcgactgggtgcccgcgcactttcccgacgatccgcacgggctc
ggcaaattcgacggcaccgcgctgttcgagcatgcggacccgcgcgagggatggcatccg
gactggcacacgcacgtgttcaacgtcgggcggcgcgaagtcggcgcgttcctgatcgcg
tcggcgctcgcgtgggcgcaccgctatcacgtcgacggcattcgcgtcgacgccgtcgcg
tcgatgctctaccgcgactactcgcgcgcggcgggcgaatgggtgccgaacgtgtacggc
gggcgcgagaacctcgaatcgatcgcgttcctgaagcacttcaacgacacgctgcacggg
cccgccgcgccgcccggcgtcgcgacgttcgcggaggaatcgaccgcatggcccggcgtc
accgcgccgaccgccgagcacggcctcggcttcgatttcaagtggaacatgggctggatg
cacgacacgctcgcctatctgcgcgaggatccgatccatcgccgccatcaccacgaccgg
ctcacgttcgggctcgtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgac
gaagtcgtgcacggcaagggctcgctcgcggccaagatgccgggcgacgcctggcagcgc
ctcgcgaacctgcgcgcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctg
ttcatgggcggcgagttcgcgcagtggggggagttcgcgcacgacgcgacgccgcagtgg
gatctgctcgacgcgcccgcgcaccggggcgtgcagcgcctcgtgcgcgacctgaaccgg
ctgcatgcggccgagccggcgctgcacgcgctcgacgaccggcccgccgggttcgcgtgg
ctcgtcggcgacgatcgcaacaacagcgtgttcgcgttcgtccgtcgcgacgatgcgggc
cgcatgctcgtcgcggtgtgcaacttcacgccggtgccgcgcaccgactatcggctcggg
ctgcccgcgccgggccgctgggccgaggtgctgaacaccgacggcgccgcatacggcggc
accgacgcgggcaacggcggcgcggtccaagccgacgagattcccgcgcacggcgagcga
tggtcggccgcgctgcgcctgccgccgctcgcgacgctatggctgcgccccgcctga

DBGET integrated database retrieval system