KEGG   Burkholderia pseudomallei NCTC 13179: BBK_3038Help
Entry
BBK_3038          CDS       T02894                                 

Definition
(GenBank) acCoA-C-Actrans: acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
bpk00071  Fatty acid degradation
bpk00072  Synthesis and degradation of ketone bodies
bpk00280  Valine, leucine and isoleucine degradation
bpk00310  Lysine degradation
bpk00362  Benzoate degradation
bpk00380  Tryptophan metabolism
bpk00620  Pyruvate metabolism
bpk00630  Glyoxylate and dicarboxylate metabolism
bpk00640  Propanoate metabolism
bpk00650  Butanoate metabolism
bpk00900  Terpenoid backbone biosynthesis
bpk01100  Metabolic pathways
bpk01110  Biosynthesis of secondary metabolites
bpk01120  Microbial metabolism in diverse environments
bpk01130  Biosynthesis of antibiotics
bpk01200  Carbon metabolism
bpk01212  Fatty acid metabolism
bpk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBK_3038
   00630 Glyoxylate and dicarboxylate metabolism
    BBK_3038
   00640 Propanoate metabolism
    BBK_3038
   00650 Butanoate metabolism
    BBK_3038
  Lipid metabolism
   00071 Fatty acid degradation
    BBK_3038
   00072 Synthesis and degradation of ketone bodies
    BBK_3038
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBK_3038
   00310 Lysine degradation
    BBK_3038
   00380 Tryptophan metabolism
    BBK_3038
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBK_3038
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBK_3038
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBK_3038
Enzymes [BR:bpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBK_3038
Exosome [BR:bpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBK_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGZ27309
Position
1:3481380..3482564
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGIAQHAPALTVNRLCGSGLQAIVSAAQNVLLGDADIAVAGGAENM
SRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRHDASLDDFTKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNALGFDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcacggcgatcggcgatttcggcggc
agcctgaaggacttcgcgccgaccgagctcggcgcgcgggtcgtgcgcgaggtgctgtcg
cgcgcgcaggtgtcgggcgacgaggtcggccacgtcgtgttcggcaatgtcgtgcacacg
gagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcatcgcgcagcac
gcgcccgcgctgacggtcaaccgtctctgcggctccggcctgcaggcgatcgtgtcggcc
gcgcagaacgtgctgctcggcgacgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtactcggtgccggccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggccgagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcccaccggcgcgcgtcgcatgcgacgaaatccggctatttcaaggatcagatc
ctgccgatcgagatcgcgtcgcgcaagggcacggtcgtgttcgacgccgacgagcacgtg
cgccacgacgcgtcgctcgacgatttcacgaagctcaagcccgtgttcgccaaggagaac
ggcacggtgacggcgggcaacgcgtcgggcatcaacgatgcggccgccgcggtggtgctg
atggagcgcggcgtcgccgacaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcacgcgggcgtcgatccggcatacatgggcatcggccccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcaccgtcgccgatctcgacgtgatcgaggcgaacgaggcg
ttcgccgcgcaggcgtgcgcggtgtcgaacgcgctcggtttcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctgtacgagctgcagcggatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system