KEGG   Burkholderia pseudomallei NCTC 13179: BBK_3584Help
Entry
BBK_3584          CDS       T02894                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BBK_3584 (rbsK)
Enzymes [BR:bpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BBK_3584 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2:154923..155855
Genome map
AA seq 310 aa AA seqDB search
METIAVIGSNMVDLVTYVTRMPADGETLEAPNFELGCGGKGANQAVAASKLGARVAMISK
LGDDLFAENTLRNFERFGVDTEHVRRVSGVSSGVAPIFVSPDSRNRILIVKGANRHLRPA
DIDAAAAKIEASRLVVLQLEIAIDTVYYAIDFAAARGIPVLLNPAPGMPDLDFARLAKLE
FLVPNETELALVSGMPTDTPDAVERAAGSLVERGVKHVIVTLGEKGSLLVSRAGAVRVPP
VAVDARDTTGAGDAYIGCFARHYVATADIPAAMRLASAYAAHSVTGLGTQKSYADAATFE
RFLQTIGFGA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagacgatcgccgtcatcggcagcaacatggtcgatctcgtgacctacgtcacgcgg
atgcccgccgacggagaaacgctcgaagcgccgaacttcgagctcggctgcggcggcaag
ggcgcgaaccaggcggttgccgcgtcgaagctgggcgcgcgcgtcgcgatgatatcgaag
ctcggcgacgacctgttcgccgagaacacgctgcgcaacttcgagcgcttcggcgtcgat
accgagcacgtgcgccgcgtgagcggcgtatcgagcggcgtcgcgccgattttcgtgagc
cccgattcgcgcaaccgcatcctgatcgtcaagggcgcgaaccggcacctgaggccggcc
gacatcgacgcggccgccgcgaaaatcgaggcgagccgcctcgtcgtgctgcaactcgag
atcgccatcgatacggtctactacgcaatcgatttcgcggccgcccgcggcattccggtg
ctgctgaatcccgcgccgggcatgccggatctcgatttcgcgcgcctcgcgaagctcgag
ttcctcgtgccgaacgagaccgagctcgcgctcgtgtccggcatgccgaccgacacgccc
gacgccgtcgagcgcgcggcgggctcgctcgtcgagcgcggcgtgaagcacgtgatcgtc
acgctaggcgagaagggctcgctcctcgtgtcgcgcgcgggcgccgtgcgcgtgccgccc
gttgccgtcgacgcgcgcgacacgacaggcgcgggcgacgcgtacatcggctgcttcgcg
cgccactatgtcgcaacggccgacatacccgccgcgatgcggctcgcctccgcgtacgcc
gcacactcggtgacgggcctcggcacgcagaagtcgtacgcggatgccgcgacgttcgag
cgcttcctgcagacgatcggcttcggcgcgtga

DBGET integrated database retrieval system