KEGG   Burkholderia pseudomallei NCTC 13179: BBK_5485Help
Entry
BBK_5485          CDS       T02894                                 

Definition
aminotransferase class-III family protein
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpk  Burkholderia pseudomallei NCTC 13179
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpk00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpk00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpk00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bpk00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2433874..2434248)
Genome map
AA seq 124 aa AA seqDB search
MAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVDPHT
RASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLREAV
GVPA
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgccgagcgagcg
accgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgagctgccgcag
atcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgatccgcacacg
cgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgagcgcgggctg
ctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcctctcaccatc
gaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagggaagcggtg
ggcgtgcccgcctga

DBGET integrated database retrieval system