KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0073Help
Entry
BURPS1106A_0073   CDS       T00480                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1106A_0073
   01212 Fatty acid metabolism
    BURPS1106A_0073
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS1106A_0073
   00650 Butanoate metabolism
    BURPS1106A_0073
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1106A_0073
   01040 Biosynthesis of unsaturated fatty acids
    BURPS1106A_0073
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1106A_0073
   00310 Lysine degradation
    BURPS1106A_0073
   00380 Tryptophan metabolism
    BURPS1106A_0073
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1106A_0073
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS1106A_0073
   00281 Geraniol degradation
    BURPS1106A_0073
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BURPS1106A_0073
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BURPS1106A_0073
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BURPS1106A_0073
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BURPS1106A_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:70390..72513
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDAAVKGMLVTSAKPDFI
AGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPEAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLIDTGEEAAARGKDYSRKLVDK
QVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVFEDRAIKADVTRRSEAVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITRQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPASGGKKALW
PGLAQEFPLAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWGFPAFR
GGPASYIHGVGVDAFVATCDRLAARHGARFAAPALLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcgaccttgagctggaacctgccggcg
cgcagccagaacgtgctgaacggcgagagctgcgaggcgttcttcgcggcggcggcgcgc
gcgttgcaggatgcggcggtgaagggaatgctcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacagcgccgagacgctcttcgcgcgc
acgtgcgagctgcatcgcgcgctgcgcgcgctcgaaacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggtgggctggagatcgcgctcgcgggccactatcgt
gtcgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgtctcgtcggcgtccaggcgtcgctgccg
ctgttgctcgaaggcaagcggctgaaggcggccgacgcgctggccgcgggcatcctgcat
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggctgctcgacgcgagc
cgccgcaccgcgacgcagccgtgggacgcgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcggcagaagacg
tatggcaactacccggccgtcgcgagcatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcttgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
gaagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaaggtcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gataccggcgaagaggcggccgcgcgcggcaaggactattcgcgcaagctcgtcgacaag
caggtgcagcgcggccggctcgcgcgggaaaaggccgatgcattgctcgcgaagatcgtg
ccgacgaccgatttcgcgcggctcgacggcgcgcagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgccggagcgaagcggtgctcgcgcccgacgcg
cttttcgcgtcgaacacgtcgacgctgccgatcacggggctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgccggtggacaagatgccgctcgtcgag
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggcatgacgccgatcgtggtcaacgattcgcggggcttctacacgagccgcgtg
ttttcgacgtacgtgctcgaagggctcgcgatgctcgccgagggcgtcgcgcccgcgctg
atcgagaacgccggattgctcgccggcatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagctgatccacaagatcaccaggcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgaactcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgagcggcggcaagaaggcgctgtgg
ccggggctcgcgcaggagtttccgctcgcggccgagcagcccgacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgatgcggacgtcggcgcgattctcggctggggtttcccggcgttccgc
ggcgggcccgcgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggcacggcgcgcgtttcgccgcgccggcgttgctgcgcgagatggcg
gcgcaggggcgaagcttctattga

DBGET integrated database retrieval system