KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0319Help
Entry
BURPS1106A_0319   CDS       T00480                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1106A_0319 (argG)
   00220 Arginine biosynthesis
    BURPS1106A_0319 (argG)
Enzymes [BR:bpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     BURPS1106A_0319 (argG)
Exosome [BR:bpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1106A_0319 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:293287..294627
Genome map
AA seq 446 aa AA seqDB search
MTTILENLPAGQKVGIAFSGGLDTSAALHWMRIKGAVPYAYTANLGQPDEDDYDAIPKRA
IQYGAEGARLIDCRAQLVAEGIAALQCGAFHISTAGVTYFNTTPIGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLVNPDLKIYKPWLDQQFIDELGGRAEMSEFMRQAG
FEYKMSAEKAYSTDSNLLGATHEAKDLESLESGIKIVNPIMGVAFWRDDVKIDKEEVTIR
FEEGRPVALNGVEYKDAVALLLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGLALL
YIAYERLVTGIHNEDTIEQYRENGRRLGRLLYQGRWFDPQAIMLRETAQRWVARAVTGEV
TVELRRGNDYSIIGTRSPNLTYQPERLSMEKVQSMFSPRDRIGQLTMRNLDITDTRDKLR
IYSQVGLLAAGESSALPKLKEDESGN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgattcttgaaaatctcccggccggccagaaggtcggcattgcgttctccggc
ggcctcgacacgagcgccgcgctgcactggatgcgcatcaagggagccgttccttacgca
tacacggccaatctcggccagcccgacgaagacgactacgacgcgatcccgaagcgcgcg
atccagtacggcgccgaaggcgcgcgcctgatcgactgccgcgcgcagctcgtcgccgaa
gggatcgcggcgctccagtgcggcgcgttccacatttcgacggccggcgtcacgtatttc
aatacgaccccgattggccgcgccgtgacgggcacgatgctcgttgccgcgatgaaggaa
gacggcgtcaacatctggggcgacggcagcacgtacaagggcaacgacatcgagcgcttc
taccgctatggcctgctcgtcaatccggatctgaagatctacaagccgtggctcgaccag
cagttcatcgacgagctcggcggccgcgcggaaatgtccgaattcatgcgccaggccggt
ttcgagtacaagatgtcggccgagaaggcgtactcgaccgattcgaacctgctcggcgcg
acgcacgaggcgaaggatctcgagagcctcgagagcggcatcaagatcgtcaatccgatc
atgggcgtcgcgttctggcgcgacgacgtgaagatcgacaaggaagaagtgacgatccgc
ttcgaagaggggcgcccggtcgcgctgaacggcgtcgagtacaaggatgcggtcgcgctg
ctgctcgaggcgaaccggatcggcgggcgccacggcctcgggatgagcgaccagatcgag
aaccggatcatcgaggcgaagagccgcggcatctatgaggccccggggctcgcgctgctg
tacatcgcatacgagcgcctcgtcaccggcatccacaacgaggacacgatcgagcagtac
cgcgagaacggccgtcgtctcggccgcctgctgtaccagggccgctggttcgacccgcag
gcgatcatgctgcgcgagacggcgcagcgctgggtcgcgcgcgcggtcacgggcgaggtg
acggtcgagctgcgccgcggcaacgattattcgatcatcggcacgcgctcgcccaacctc
acgtaccagccggagcgcctgtcgatggagaaggtgcaatcgatgttctcgccgcgcgac
cggatcggccaactgacgatgcgcaacctcgacatcaccgatacgcgcgacaagctgcgc
atctattcgcaagtcggcctgctggcggcgggcgaatcgtcggcgctgccgaagctgaag
gaagacgagagcggcaactga

DBGET integrated database retrieval system