KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0405Help
Entry
BURPS1106A_0405   CDS       T00480                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bpl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:369219..370622
Genome map
AA seq 467 aa AA seqDB search
MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEAGQ
LTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAIAPGSDANGN
KTVNRCGVGNGTPATTLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQ
AVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADGRNLLAELQAKGYAVVATK
DQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLRKNPNGYFL
MVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSDTLIVVTADHDHTMTINGYS
KRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRPNVRVPVDSSTATNDAYLQEVG
VRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKAAFGF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcggcggcggcgttcgccgcggcggccctctcgggcggt
ttcggccacgcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgac
gggatggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaagccggccaa
ctgacgatggaaaagctgccgcgcaccgcgcgcatcaagaccttctcgaacgacgcgcag
acgacggacagcgcaccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgag
gtgctgtcgatgtcgccggacacgcgcgcgatcgcccccggcagcgatgcgaacggcaac
aagacggtgaaccgctgcggcgtgggcaacggcacgccggcgacgacgctgctcgagctc
gcgaaggcgcgcggcaaggcggtcggcgcgatcacgacgaccgagctcacgcacgcgacg
cccgcggcgacttactcgcacatctgccatcgcgacgcgcagtacgacattgccgcgcag
gccgtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatg
ggcggcggccgcaatcactggacgccgtacgatccgctcgccaacaggcgcggccgcgcg
gacgggcgcaacctgctcgccgagctgcaggcgaagggctacgcggtggtcgcgacgaag
gatcagctcgcgcaggcgggcgcgggcaagctgatcggccttttcagcacgacgagccat
ctcgaatacgagctcgaccgcgtcgcgggcaagggcgagggcgcgacgcagccgagcctc
gcggagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctg
atggtcgaaggcgggcgcatcgaccacgcgctgcacggcacgaacgcgaagcgcgcgctc
gaagacacggtggcgttcgacgaggcgatccgcaccgcgctcgcgaaggtcgatctatcg
gatacgctgatcgtcgtgacggccgatcacgatcacacgatgacgatcaacggctattcg
aagcgcggcaatccggtgctcgacatcagccgcaactatcgcgacggccagccgaacaag
gacgcggacggcaacccgtacacgacgctcgtgttcggcaatggcgcgaaccggccgaac
gtgcgcgtgccggtggattcgtcgacggcgacgaacgacgcgtatctgcaggaagtcggc
gtgcgcatgggcagcgcgggttccgagacgcatggcggcggcgacgtgatgctgttcgcc
gacggcgccggcgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctc
gtgaaggccgcgttcgggttctga

DBGET integrated database retrieval system