KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0439Help
Entry
BURPS1106A_0439   CDS       T00480                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00071  Fatty acid degradation
bpl00280  Valine, leucine and isoleucine degradation
bpl00281  Geraniol degradation
bpl00310  Lysine degradation
bpl00360  Phenylalanine metabolism
bpl00362  Benzoate degradation
bpl00380  Tryptophan metabolism
bpl00410  beta-Alanine metabolism
bpl00627  Aminobenzoate degradation
bpl00640  Propanoate metabolism
bpl00650  Butanoate metabolism
bpl00903  Limonene and pinene degradation
bpl00930  Caprolactam degradation
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01212  Fatty acid metabolism
Module
bpl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS1106A_0439
   00650 Butanoate metabolism
    BURPS1106A_0439
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1106A_0439
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1106A_0439
   00310 Lysine degradation
    BURPS1106A_0439
   00360 Phenylalanine metabolism
    BURPS1106A_0439
   00380 Tryptophan metabolism
    BURPS1106A_0439
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1106A_0439
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS1106A_0439
   00281 Geraniol degradation
    BURPS1106A_0439
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1106A_0439
   00627 Aminobenzoate degradation
    BURPS1106A_0439
   00930 Caprolactam degradation
    BURPS1106A_0439
Enzymes [BR:bpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BURPS1106A_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABN90651
UniProt: A3NQV1
Position
I:404802..405629
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctctatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgctcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcgatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system