KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0556Help
Entry
BURPS1106A_0556   CDS       T00480                                 

Definition
glycosyl hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1106A_0556
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BURPS1106A_0556
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS1106A_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(526713..529214)
Genome map
AA seq 833 aa AA seqDB search
MNRISHSLCAALLAAATLLPTASRAQLPARPMAGAAAPATAAPVRPASTPAELAARLANG
LAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPLTDGGWKLYLHSIRRLL
RIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYWLRRYSDVIPRPYVVVDG
AAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVANRALPSVKRQRALPGALD
LRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAPRRLPADIAVPGGYRLAIGP
RGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAPRFTHRGMHVDLARNFKPAAT
LRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDVGARRCHDPSETRCLLPQLGSG
PDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAHSRAAVVSMEARYRRLHAAGRER
EANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALNFASKVIREIASMHADAQAPLRIW
HFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKPWARSPACTALLRRGEIKSIDELP
TRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFSTRHVMVSLWDTIFWGASDSARDLS
AKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVFGDRD
GNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMVYPRLLALAERAWHKADWELPYAA
GVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLERAGIGYRKPTFTLTGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatttcgcattccctgtgcgccgcgctattggccgccgcgacgctgttgccc
acggcctcgcgcgcgcaactgcccgcgcgccccatggccggcgcggccgcgcccgcgacg
gccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctcgccaacggc
ctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtgccgtgcgcc
gacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcagaatcgcggc
cactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgccggctgctc
cgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctatacgagctgacg
ccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccgttcgtcgcc
gaatactggctgcgccgctacagcgacgtgatcccgcgcccgtacgtggtcgtcgacggc
gcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctacgtcgaaacg
ctgcccgccgacgcgcagaacaattcgcccggcaatgcgccgcccgccgccgcgcagccg
gtggcgaaccgcgcgctgcccagcgtgaagcggcagcgcgcgctgcccggcgcgctcgat
ctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcggcgctgcgc
gaacgtgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggcgtcgtcgcg
ccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcgatcggcccg
cgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtgcagacgctc
ttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaagacgcgccg
cgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccggccgccacg
ctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcatctgcacctg
tccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgaccgacgtcggc
gcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctcggctcgggg
cccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcgctgctgcgc
tacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcgcactcgcgc
gcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggccgcgagcgg
gaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctgaccgtgcag
ttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaacttcgcgtcg
aaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctgcggatctgg
cacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccagccgctcgac
ggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccgtgggcgcgc
tcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgacgaattgccg
acgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggcacgatggcc
gcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacgcggcacgtg
atggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgcgatctgagc
gcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgatttcccgtac
acgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggacgagtacaag
gtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggcgatcgcgac
ggcaacccgttcgaggtgacgagcgcaggcgcggcgccgagcatcgagggcatccagggg
caggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtgtatccgcgc
cttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccctacgcggcc
ggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctcgagcgcgac
tgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgagcgtgcgggc
atcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system