KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0817Help
Entry
BURPS1106A_0817   CDS       T00480                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00020  Citrate cycle (TCA cycle)
bpl00640  Propanoate metabolism
bpl00660  C5-Branched dibasic acid metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Module
bpl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BURPS1106A_0817 (sucC)
   00640 Propanoate metabolism
    BURPS1106A_0817 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BURPS1106A_0817 (sucC)
Enzymes [BR:bpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BURPS1106A_0817 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABN89097
UniProt: A3NRX7
Position
I:802004..803170
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQK
VVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREI
LKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcgcaagagctgggcggc
ccggtctgggtcgtcaaggcccagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaagtgcgcgaatactcgaaccagatcctcggcatgcaa
ctgaagacgcaccagacgggcccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtatgtcggcatcgtgatcgatcgcgtgtcgcagaag
gtcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgcggaaaagacg
ccggaagcgatccacaaggtcgccgtcgagccgtcggtgggcctgcaggacgccgaagcc
gacgatctcgcgaagaagatcggcgtgccggacgcatcgatcccgcaagcgcgcgaaatc
ctgaagggcctgtacaagtcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctcgtgctgacgggcgacggcaaggtgatcgcgctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctggcgatggcgacgatggatacgatcaagctgttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcgggctcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
cttgcggaatccggcctgccgatcatctcggcggacagcatggaagaagcggcgcagaag
gtcgtcgccgcggctgcgggcaagtaa

DBGET integrated database retrieval system