KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_0976Help
Entry
BURPS1106A_0976   CDS       T00480                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BURPS1106A_0976
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BURPS1106A_0976
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BURPS1106A_0976
Lipid biosynthesis proteins [BR:bpl01004]
 Desaturase
  First
   BURPS1106A_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:959804..961000
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSNGLLRFSWWQIVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPIMSHFFR
AWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETM
RKYGHGTPNDWLERNVYSKYPILGVSLMMVIDVALFGLVGLTVWAVQMVWIPFWAAGVVN
GLGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELAHL
KELGAREKYQLMRGARKWFHKDEAGLDEPQKRMLPEIFANSQKLHTFFQLRAELTAIWER
SNASREQLLTQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcag
atcgtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatctg
catcgctgccaggcacaccgcgcgctcgatctgcatccgatcatgagccacttcttccgc
gcctggctgtggatgacgacgggcatgctgacgggccagtgggcggcgatccatcgcaag
caccatgcgaagtgcgagaccgaggaggatccgcacagcccgcagacgcgcggcatctgg
aaggtgctgctcgaaggcgccgagctgtatcgcgcggaggcgaagaacgaggagacgatg
cgcaagtacggccacggcacgccgaacgactggctcgagcgcaacgtctactcgaaatac
ccgattctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcctcgtcggc
ctcaccgtctgggcagtccagatggtatggatcccgttctgggcggcgggcgtcgtcaac
ggtctcggccacttctggggctaccgcaacttcaacgcggccgacgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaggagctgcacaacaatcatcatacgtttgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcgttcgggctcgcgaaggtaaagaagatcgcgccgacgccgcggctcgcc
gcgcgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgttacgag
gtgatggcgcgctatgcgaagacgctcaagcgcgcgtacaggcaggagctcgcgcacctg
aaggagctgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaaatggttccac
aaggacgaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaac
agccagaagctgcacacgttcttccaactgcgcgccgagctcacggcgatctgggagcgc
tcgaacgcctcgcgcgaacagttgctcacgcagttgcaggactggtgccatcgcgccgag
caaagcggcatcaaggcgttgcaggagttcgcgacgcgcctgcgccgctacgcgtga

DBGET integrated database retrieval system