KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1421Help
Entry
BURPS1106A_1421   CDS       T00480                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpl  Burkholderia pseudomallei 1106a
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:1394958..1395443
Genome map
AA seq 161 aa AA seqDB search
MRLSQAGWTALRIREHAVMAYYNDAANNCTYGVGTLAHTGPCTPDERARPVTEAQVNAQL
ATRVSRAEAAVRRNVTTRELTQDQFDELVSYTYNAGDTGARAALQAANLSNDAGVVSHMN
QRVYIHPRDANGRRLAPVRSNGLVNRRRLETAPFRRQPGAQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgagccaggcgggatggaccgcgctgcgcatccgcgaacacgcggtcatggcc
tactacaacgacgcggcgaacaactgcacgtatggcgtcggcacgctcgcgcacaccggg
ccatgcacgcctgacgaacgggcgcgcccggtgaccgaggcgcaggtgaacgcgcaactc
gccacgcgcgtcagccgcgcggaggccgcggtgcgccggaacgtcaccacccgcgagctc
acgcaggaccagttcgacgagttggtcagctacacgtacaacgccggcgacaccggcgcg
cgcgccgcgctgcaggccgcgaacctgagcaacgacgccggtgtcgtgtcccacatgaac
cagcgggtctacatccacccgcgcgatgcgaacggccgccgcctggcgccggtacgctcc
aacgggctcgtcaaccgacgccgtctcgagactgcgccgttccgccgtcagccgggtgcg
caatga

DBGET integrated database retrieval system