KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1539Help
Entry
BURPS1106A_1539   CDS       T00480                                 

Definition
(GenBank) AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00620  Pyruvate metabolism
bpl00640  Propanoate metabolism
bpl00680  Methane metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_1539
   00620 Pyruvate metabolism
    BURPS1106A_1539
   00640 Propanoate metabolism
    BURPS1106A_1539
  Energy metabolism
   00680 Methane metabolism
    BURPS1106A_1539
Enzymes [BR:bpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BURPS1106A_1539
Lipid biosynthesis proteins [BR:bpl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BURPS1106A_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABN89460
UniProt: A3NTZ0
Position
I:complement(1493653..1495278)
Genome map
AA seq 541 aa AA seqDB search
MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEHAHGVVARYTFDELR
SSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGVLAFDAALAAESDTF
RPADTSADDPALIIYTSGTTGKPKGTLHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHGVTHAFLPPTALKLMRAAVA
RPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECNVVLSSCSALFEPRA
GTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRRPEATREKFAGDFLL
TGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVRMAAVVGVPDAVRTE
IVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLPMTATGKIIRRALRD
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacgccgcccattacgccgagctcgtcgagcgcttcgcctggcgggttccc
gcgcactacaacatcggcgtcgacgcgtgcgacaaatgggccgatggcagcggccgcctc
gcactgatccacgaacacgcgcacggcgtcgtcgcacgttacacgttcgacgaactgagg
agcagctctaatcgactcgcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgc
atcggcatcctcctcgcgcaaggcccggaaacggcgatcgcccatctggccgcatacaag
ctcggcgcgatcgcggtgccgctcttcacactcttcggcgcggacgcgctcgaattccgc
ctcggcgatagcggcgccgtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcg
ccgctgcatgcgtcgctgccgtcgctcgcgacgatctactgcatcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcgttcgatgcggcgctcgcggccgaatcggacacgttc
cggccggcggacacgtcggccgacgatccggcgctcatcatctacacgtccggcacgacg
ggcaaaccaaagggcacgctgcacgcgcatcgggtgctgctcggccatctgcccggcgtc
gagatgtcgcagaacctgtttccggcgcgtgcgcgcctgttctggacgcccgccgattgg
gcatggatcggcgggctgctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtc
ctcgcgcgacgcttcgagaaattcggcggcgcggccgcgttcgatctgctcgcccggcac
ggcgtgacgcacgcgttcctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcg
cggccgcgtgaacgttacgcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctc
ggcgccgaactcgtttcctggggccgcgacgcgttcggcgtgacgatcaacgagttctac
ggacagaccgaatgcaacgtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcg
gggacgatcggcaaggcggcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaac
gcgctgccgcccggcgtcacgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttc
atcggctactggcgcaggcccgaggcgacgcgcgagaagttcgccggcgacttcctgctg
acgggcgacctcggcatcgccgacgccgacggtttcatccgcttcgtcggccgcaacgac
gacgtgatcacgagcgccggctaccggatcggcccgggaccgatcgaggattgcctgctc
gagcatccggcggtgcggatggcggccgtcgtcggcgtgccggacgcggtccgcaccgaa
atcgtcaaggcgttcgtcgtgctgaacgccggctatgaaggaagcgccgcgctcgcccgc
gagctgcaaacgcacgtgaagacacggctcgccgcacacgaatatccgcgtgcgctcgcc
ttcgtcgacagcctgccgatgaccgcgaccggcaagatcatccgccgcgcgctgcgcgac
atctga

DBGET integrated database retrieval system