KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1548Help
Entry
BURPS1106A_1548   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1500410..1500577
Genome map
AA seq 55 aa AA seqDB search
MSIQFSYRKESSCAFSASMIFDIRVKISGKSNATSEASRKLAVMFIEDLRVEESR
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatccagttctcgtatcgcaaagagtcgtcgtgcgccttcagcgcgtcgatgatt
ttcgatatccgcgtcaagatctcgggaaaatcgaatgcgacgagtgaagcatcgcggaaa
ctggcggtgatgttcatcgaggatctcagggttgaagaatcgaggtaa

DBGET integrated database retrieval system