KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1566Help
Entry
BURPS1106A_1566   CDS       T00480                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1518312..1520528)
Genome map
AA seq 738 aa AA seqDB search
MTDAPFDRADIDALLDARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQVDPAGCFAGALPDGRERGERPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARASLDLAHAPVSIYEVHPESWLRVAAEGNRSATWDELAQRLIPYAAGMGFSHVELTP
IAEYPFGGSWGYQSLSPFAPSARFGPPEGFARFVEHAHAAGLGVIVDWVPAHFPDDPHGL
GKFDGTALFEHADPREGWHPDWHTHVFNVGRREVGAFLIASALAWAHRYHVDGIRVDAVA
SMLYRDYSRAAGEWVPNVYGGRENLESIAFLKHFNDTLHGPAAPPGVATFAEESTAWPGV
TAPTAEHGLGFDFKWNMGWMHDTLAYLREDPIHRRHHHDRLTFGLVYAFSERFVLPLSHD
EVVHGKGSLAAKMPGDAWQRLANLRAYFGFMWAHPGKKLLFMGGEFAQWGEFAHDATPQW
DLLDAPAHRGVQRLVRDLNRLHAAEPALHALDDRPAGFAWLVGDDRNNSVFAFVRRDDAG
RMLVAVCNFTPVPRTDYRLGLPAPGRWAEVLNTDGAAYGGTDAGNGGALQADEIPAHGER
WSAALRLPPLATLWLRPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcgacgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcaggtcgatccggccggctgcttcgccggcgcgctgcccgatgggcgggaacgcggc
gagcggccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgctgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccat
ccggaatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctc
gcgcagcggctgattccgtatgcggccggcatgggcttctcgcacgtcgagctcacgccg
atcgccgagtatccgttcggcggctcgtggggctaccagtcgctatcgccgttcgcgccg
tccgcgcggttcgggccgccggaaggcttcgcgcgcttcgtcgagcacgcgcacgcggcc
ggcctcggcgtgatcgtcgactgggtgcccgcgcactttcccgacgatccgcacgggctc
ggcaaattcgacggcaccgcgctgttcgagcatgcggacccgcgcgagggatggcatccg
gactggcacacgcacgtgttcaacgtcgggcggcgcgaagtcggcgcgttcctgatcgcg
tcggcgctcgcgtgggcgcaccgctatcacgtcgacggcattcgcgtcgacgccgtcgcg
tcgatgctctaccgcgactactcgcgcgcggcgggcgaatgggtgccgaacgtgtacggc
gggcgcgagaacctcgaatcgatcgcgttcctgaagcacttcaacgacacgctgcacggg
cccgccgcgccgcccggcgtcgcgacgttcgcggaggaatcgaccgcatggcccggcgtc
accgcgccgaccgccgagcacggcctcggcttcgatttcaagtggaacatgggctggatg
cacgacacgctcgcctatctgcgcgaggacccgatccatcgccgccatcaccacgaccga
ctcacgttcgggctcgtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgac
gaagtcgtgcacggcaagggctcgctcgcggccaagatgccgggcgacgcctggcagcgc
ctcgcgaacctgcgcgcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctg
ttcatgggcggcgagttcgcgcagtggggggagttcgcgcacgacgcgacgccgcagtgg
gatctgctcgacgcgcccgcgcaccggggcgtgcagcgcctcgtgcgcgacctgaaccgg
ctgcatgcggccgagccggcgctgcacgcgctcgacgaccggcccgccgggttcgcgtgg
ctcgtcggcgacgatcgcaacaacagcgtgttcgcgttcgtccgtcgcgacgatgcgggc
cgcatgctcgtcgcggtgtgcaacttcacgccggtgccgcgcaccgactatcggctcggg
ctgcccgcgccgggccgctgggccgaggtgctgaacaccgacggcgccgcatacggcggc
accgacgcgggcaacggcggcgcgctccaagccgacgagattcccgcgcacggcgagcga
tggtcggccgcgctgcgcctgccgccgctcgcgacgctatggctgcgccccgcctga

DBGET integrated database retrieval system