KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1600Help
Entry
BURPS1106A_1600   CDS       T00480                                 

Definition
(GenBank) outer membrane efflux protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1550332..1551219)
Genome map
AA seq 295 aa AA seqDB search
MRPSQARTETARAGGASAPRDARRHAHRGGAHAPAVRCGAPPIVGRTRPPTKTIRDDLRA
ESCRMPGWIRRTHAWIGEMPARTDRRDAQAIAPARRPDVPGAYAAAQASAAKIKAAEAEF
MPKVFVSASTPYNAGRAAITAIPPVGQQAPTVNLNGSRYGGGVFVGVTISRYDGGLRSAV
LMQARNDAGSASARLERTKDEGRSGQADRRRAERAARESRVARCGGDARRRRADHCDAAL
DAYRHGVGSITDAMPARNDLLAAQTAYADSYGAALSAAASLALATGTVAQTPEAQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgcggccgtcgcaggcgaggacggaaaccgcgcgtgcgggcggcgcaagcgcgccgcgc
gatgcgcggcggcacgcgcatcgcggcggtgcgcacgcgccggcggtgcgatgcggcgcg
ccgccgatcgtcggccgcactcgcccgccgacgaaaaccatccgcgacgacctgcgcgcc
gaatcatgccggatgccaggttggattcgccgcacgcacgcatggatcggcgagatgccc
gcgcgtacggatcgacgagacgcacaggcgatcgcgcccgcgcgccgcccagacgtgccg
ggcgcgtacgcggccgcgcaggcgagcgcggcgaagatcaaggcggcggaagcggagttc
atgccgaaggtgttcgtgtccgcgtcgacgccgtacaacgccgggcgcgcggcaatcacc
gcgatcccgcccgtcggccagcaggcgccgaccgtgaacctgaacggcagccgctacggc
ggcggcgtgttcgtcggcgtgacgatttcgcggtacgacggcggcttgcgctcggccgtg
ctgatgcaggcgcgcaacgacgccggcagcgcatccgcgcggctcgagcgcacgaaggac
gaaggacgaagcggtcaggcagatcgtcgccgggcagaacgcgctgcgcgcgagtctcgc
gtcgcacgatgcggcggcgacgctcgtcgacgccgcgcagaccactgcgacgccgcgctc
gacgcgtaccggcacggcgtcggctcgatcaccgacgcgatgcccgcgcggaacgacctg
ctcgccgcgcaaaccgcgtacgcggacagctacggcgccgcgctgtcggccgcggcgtcg
ctcgcgctcgcgacggggacggtcgcgcagacgccggaggcgcaatga

DBGET integrated database retrieval system