KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1611Help
Entry
BURPS1106A_1611   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABN92553
UniProt: A3NU61
Position
I:1567209..1567652
Genome map
AA seq 147 aa AA seqDB search
MSSAVAMSRGPVRVDIKRIDGQPAARIPESDDTGNEWVRLHIAGVGRATGPASPAVVYWV
ITVPDDVPPVYLKRGECVVFGQRIPGATVETPPKPFDVDKRYNFALVTSSESGAWIYKGN
FCVREKLGSGTRAVLLNEDSDPCPRGR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggccgtggcaatgtcgcgcggcccggtgcgcgtggacatcaagcggatcgat
ggtcaaccggccgcccgtattccggagagcgacgatacgggcaacgagtgggtacgtctt
catatcgccggtgtcggcagagcgacggggcccgctagtccggccgtcgtttattgggtt
atcaccgtgccggacgatgtgccacccgtttatctgaagcgcggcgaatgcgtcgttttc
ggacaaaggatccccggggcgacggtggagacgccgccgaagccgttcgatgtcgacaaa
cggtacaactttgcgctcgttacgagcagtgagagtggagcctggatatacaagggcaat
ttttgcgtgcgcgagaagctcggcagtgggacgcgcgcggtgttactcaacgaagacagc
gatccttgcccgcggggacgatga

DBGET integrated database retrieval system