KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1625Help
Entry
BURPS1106A_1625   CDS       T00480                                 

Definition
(GenBank) major facilitator family transporter
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_2 MFS_1_like LacY_symp PhoLip_ATPase_C DUF4381 OATP
Motif
Other DBs
NCBI-ProteinID: ABN89155
UniProt: A3NU75
Position
I:complement(1579840..1581177)
Genome map
AA seq 445 aa AA seqDB search
MRAFSRSLIETSFWRARVNWYKEISPVERRTFKGCFSGWALDGVDTQMFSLVIPALLTAW
GIGKGQAGLIGGATLAAGAIGGLLAGMIADRFGRVRALQITVCWFSLFTFLSAFAQNFEQ
LLVLKTLQGLGFGGEWTAGAVLLSETIRARHRGKAMGIVQSAWGFGWGGAVLLYTLVFSW
LPPEWAWRVLFAIGVLPALLVLYIRRAIPEPPRDDARVAVSTSAAAAQTAPARASAKSIF
DPSVLRMTIVGGLIGVGAHGGYHAITTWLPTYLKTERHLSVLGTGAYLAVIIVAFIIGCM
TSAYLQDRIGRRRNLMLFSACCVVTVNLYVMLPLDNVAMLLLGFPLGFFAAGIPATLGAL
FNELYPRNVRGRGVGFCYNFGRVASAIFPVLVGHMGTSMPLGVALGIDAGIAYGLVFVAV
WFLPETRARDIQPSQPEARIREAAL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctttttctcgatcgctgattgagacatcattctggagagcgcgagtgaactgg
tacaaagaaatatcgcccgtggaaagacgcacgttcaaaggatgtttttccggctgggcg
ctcgacggcgtcgatacgcagatgttcagcctcgtgattccggcgctgctcacggcatgg
ggcatcggcaagggacaggcgggcctgatcggcggcgcgacgctcgccgcgggtgcgatc
ggcggcctgctcgccggcatgatcgccgatcgcttcggccgcgtgcgtgcgctgcagatc
accgtgtgctggttctcgctgttcacgttcctcagcgcgttcgcgcagaacttcgagcaa
ttgctggtgctgaagacgctgcaagggctcggcttcggcggcgaatggacggcgggcgcc
gtgctgttgagcgagacgattcgcgcgcggcaccgcggcaaggcgatgggcatcgtgcag
agcgcatggggcttcggctggggcggcgcggtgctcctctacacgctcgtcttctcgtgg
ctgccgcccgaatgggcgtggcgcgtgctgttcgcgatcggcgtgctgcccgcgctgctc
gtgctgtacatccggcgcgcgattcccgagccgccgcgcgacgacgcacgcgtggccgtt
tccacatcggccgcggctgcgcagaccgcgccggcacgcgcgtcggcgaagagcatcttc
gatccgtcggtgctccggatgacgatcgtcggcggcctgatcggcgtcggcgcgcacggc
ggctatcatgcgatcacgacctggctgccgacctacctgaagaccgaacgtcatctctcg
gtgctcggcacgggcgcgtatctcgccgtgatcatcgtcgcgttcatcatcggctgcatg
acgagcgcctacctgcaggaccgcatcggccgccgcaggaatctgatgctgttctccgcg
tgctgcgtcgtgacggtcaacctgtacgtgatgctgccgctcgacaacgtcgcgatgctg
ctgctcggctttccgctcggcttcttcgcggccggcatcccggccacgctcggcgcgctc
ttcaatgagctctatccgagaaacgtgcgtggccggggcgtcggcttttgctacaacttc
ggacgcgtggcgtcggcgatcttcccggtgctggtcggacacatgggcacgtcgatgccg
ctcggcgtcgcgctcggcatcgacgcgggcatcgcgtacgggctcgtgttcgtcgccgtg
tggttcctgcccgagacgcgcgcgcgcgatatccagccgtcgcaacccgaggcccggatc
cgcgaggccgcgctctag

DBGET integrated database retrieval system