KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1640Help
Entry
BURPS1106A_1640   CDS       T00480                                 

Gene name
rcsB
Definition
(GenBank) capsular synthesis regulator component B
  KO
K07687  
two-component system, NarL family, captular synthesis response regulator RcsB
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BURPS1106A_1640 (rcsB)
Two-component system [BR:bpl02022]
 NarL family
  RcsC-RcsD-RcsB [MD:M00474]
   BURPS1106A_1640 (rcsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1591799..1592431
Genome map
AA seq 210 aa AA seqDB search
MSVQVLIADDHPLVLLGVRHMLAGMGDVSIVGEAHDPAGLLALLAATPCDIVITDFAMPE
QPAADGLAMLTAIRDGYPSVRVIVLTMLDNPVLMHTMRQAGALAVLSKRGDLDELPRALA
AVYQGRPFVGTHAGAAGGGAMRGTDAPRQLSPREIEVVRLCATGMTMTDIANRYGRSIKT
VSTHKHNAMGKLGLKSDVDLFMYATENGLV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcaagtgttgatcgcggacgaccatccgctcgtgctgctgggcgtgcgccac
atgctggcgggcatgggcgacgtatcgatcgtcggcgaagcgcatgacccggcggggctg
ctcgcgctgctcgcggccacgccgtgcgacatcgtcatcaccgatttcgcgatgcccgag
cagccggccgccgacggcctcgcgatgctcaccgcgatccgcgacggctatccctcggtt
cgcgtgatcgtgctgacgatgctcgacaatccggtgctgatgcacacgatgcgccaggcg
ggcgcgctcgcggtgctcagcaagcgcggcgacctcgacgagctgccgcgcgcgctcgcc
gccgtgtaccaggggcggccgttcgtcggcacgcacgcgggcgcggcgggcgggggagcg
atgcgcgggaccgacgcgccgcggcaactgagcccgcgcgagatcgaggtggtgcggcta
tgcgcgaccgggatgacgatgaccgacatcgcgaaccgctatggccgcagcatcaagacg
gtcagcacgcacaagcacaacgcgatgggcaagctcgggctgaaatcggacgtcgatctg
ttcatgtacgcgacggagaacgggctggtctga

DBGET integrated database retrieval system