KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1651Help
Entry
BURPS1106A_1651   CDS       T00480                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1106A_1651
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BURPS1106A_1651
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS1106A_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1603687..1605786
Genome map
AA seq 699 aa AA seqDB search
MKRRECRGNARGKDSVKMRKKSLVHLPVALAVAAALGACSGDDDATLESRADAIVERMTT
RQKVGQKLMMAFRYWCPDGQPACTAGMTEFPDAARDALRENGIGGVILFSNNLTGIEQTR
RLIDGIRAAPAADSPLGLMIGIDEEGGNVFRLPRVEASAFAGNMALGAAYEATRDDRLAY
DMGRVLAAEIAAVGFNVNFAPDVDVNSNPLNPVINVRAFGDDPATIGLLGRRMVQGMKSE
RVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQ
YPSLDDTRVATRTGEQMIAPATMSRRIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDD
AVVKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTK
LRHGIVASDRGRPVDELASIGGPAHRAIERDIAQKSITVLRNENGALPLQAAGRRIFILT
PWGEQAEAMRRRFVELGHPLVTGAKLSAITWAEQQQAIDAADVVIVGTLSTGVTPVEHNG
DPNARVSPPAPSAVRMRQAAPANGEEEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEA
QQMRDAMDYAKARRKTVIHVTMRAPYDVISYDDVADATLATYAYYGYEGGLRGPSLPAAV
DAMLGVARPVGRLPVAIHALNADGSTGPLRYARGFGLQY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgaatgccgcgggaatgcgcgcggcaaggattcggtgaagatgcgcaag
aaaagcttggttcatttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcg
ggcgacgacgacgcgacgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacc
cggcagaaggtcggccagaaactgatgatggcgttccggtactggtgccccgacgggcag
cccgcgtgcacggccggcatgaccgaatttcccgacgccgcgcgcgacgcgctgcgcgag
aacggcattggcggcgtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgc
cggctgatcgacggcattcgggccgcgcccgcggccgacagcccgctcgggctgatgatc
ggcatcgacgaggagggcggcaacgtgtttcgcctgccgcgcgtcgaggcgagcgcgttc
gccggcaacatggcgctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtac
gacatgggccgcgtgctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcg
ccggacgtcgacgtcaacagcaatccgctcaatccggtgatcaacgtgcgcgcgttcggc
gacgatccggcgacgatcggcctgctcggccggcgcatggtgcagggcatgaagagcgag
cgcgtgatcggcacgttcaagcattttcccgggcacggcgacacggataccgattcgcac
tacggattgcccgtcgtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccg
taccggcaggcgatcgaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccag
tatccgtcgctcgacgacacccgcgtcgcgacccgcacgggcgagcagatgatcgcgccc
gcgacgatgtcgcggcgcatccagcacgatatcctgcgcggcgagttcggctatcagggc
gtgacgatcaccgacgcgctcgacatgaagggcatcgccggcttcttcgacgaggacgac
gcggtcgtcaaggtgttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgc
accgcggccgatgccgggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgat
tcggggcggatcgatcgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaag
ctgcgccacggcatcgtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatc
ggcgggcccgcgcaccgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctg
cgcaacgagaacggcgcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacg
ccgtggggcgagcaggccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctc
gtcacgggcgcgaagctgagcgcgatcacgtgggccgaacagcagcaggcgatcgatgcg
gccgacgtcgtgatcgtcggcacgctgtcgacgggcgtcacccccgtcgagcacaacggg
gatccgaacgcgcgcgtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcg
cccgcgaacggcgaggaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcg
gcgaaggacatcggcgcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcg
cagcagatgcgcgacgcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtg
acgatgcgcgcgccgtacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgcc
acctacgcgtactacggctacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtc
gacgcgatgctcggcgtcgcgcggccggtcggcaggctgccggtcgcgatccacgcgctg
aacgcggacggatcgacggggccgctgcgctacgcgcgcggattcgggttgcagtactga

DBGET integrated database retrieval system