KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1660Help
Entry
BURPS1106A_1660   CDS       T00480                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00970  Aminoacyl-tRNA biosynthesis
Module
bpl_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BURPS1106A_1660 (alaS)
Enzymes [BR:bpl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     BURPS1106A_1660 (alaS)
Amino acid related enzymes [BR:bpl01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BURPS1106A_1660 (alaS)
Transfer RNA biogenesis [BR:bpl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BURPS1106A_1660 (alaS)
 Prokaryotic Type
    BURPS1106A_1660 (alaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Tropomyosin_1 CCDC144C Lectin_N ATG16 SKA2 Prefoldin_2
Motif
Other DBs
NCBI-ProteinID: ABN89087
UniProt: A3NUB0
Position
I:1611604..1614228
Genome map
AA seq 874 aa AA seqDB search
MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTSVYKLP
ADKLWVTVYHDDDEAYDIWAKEVGVPAERIIRIGDNKGARYASDNFWQMGDTGPCGPCSE
IFYDHGPDVWGGPPGSPEEDGDRYIEIWNLVFMQFNRDAQGNMTRLPKPCVDTGMGLERI
AAVLQHVHSNYEIDLFQQLIKASARETGVADLANNSLKVIADHIRACSFLIVDGVIPGNE
GRGYVLRRIVRRAIRHGYKLGRKAPFFHKLVADLVAEMGAAYPELKEAEPRVTDVLRQEE
ERFFETIEHGMSILEAALAELDAAGGKTLDGELAFKLHDTYGFPLDLTADVCRERGVTVD
EPAFDDAMARQREQARAAGKFKATQGLEYTGAKTTFHGYEEIAFDDAKVVALYVEGASVG
EVKAGESAVVVLDHTPFYAESGGQVGDQGVLANAATRFAVGDTLKVQADVIGHHGELEQG
TLKVGDVVRAEIDAARRARTARNHSATHLMHKALRDVLGSHVQQKGSLVDADKTRFDFAH
NAPLTDDEIRRVEAIVNEQVLANAPGIVRVMPYDDAVKGGAMALFGEKYGDEVRVLDLGF
SRELCGGTHVHRTGDIGLFKIVAEGGVAAGIRRVEAITGDNAVRYVQALDARVNAAAAAL
KAQPSELLQRIGQVQDQVKSLEKELGALKSKLASSQGDELAQQAVEVGGVHVLAATLDGA
DAKTLRETVDKLKDKLKSAAIVLAAVDGGKVSLIAGVTADASKKVKAGELVNFVAQQVGG
KGGGRPDMAQAGGTEPAKLPAALAGVKGWVEARL
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgaaatccgcgagaaattcctcaagttcttcgaatcgaagggccacacg
atcgtccgctcgtcgagcctcgtgcccggcaacgaccccacgctgctcttcaccaattcg
ggaatggtgcagttcaaggacgtgttcctcggcgcggagacgcgcccgtattcccgcgcg
accaccgcgcagcgcagcgtgcgcgcgggcggcaagcacaacgatctcgagaacgtcggc
tacaccgcgcgtcaccatacgttcttcgagatgctcggcaacttctcgttcggcgattac
ttcaagcgcgacgcgatccattacgcgtgggagctgctgacgagcgtctacaagctgccc
gccgacaagctctgggtcaccgtctaccatgacgacgacgaagcctatgacatctgggcg
aaggaagtcggcgtgcctgccgagcggatcatccggatcggcgacaacaagggcgcgcgc
tacgcgtcggacaacttctggcagatgggcgacaccggcccgtgcggcccgtgctcggaa
atcttctacgaccacggcccggacgtgtggggcggcccgcccggatcgcccgaggaagac
ggcgaccgctacatcgagatctggaacctcgtgttcatgcagttcaaccgcgacgcgcag
ggcaacatgacgcgcctgccgaagccgtgcgtcgacaccggcatgggcctcgagcggatc
gcggccgtgctgcagcacgtgcacagcaactacgagatcgatctgttccagcagttgatc
aaggcgtcggcgcgcgagacgggcgtcgccgatctcgcgaacaactcgctgaaggtgatc
gccgatcacatccgcgcgtgctcgttcctgatcgtcgacggcgtgatccccggcaacgaa
ggccgcggctacgtgctgcgccggatcgtgcgccgcgcgatccgccacggctacaagctc
ggccgcaaggcgccgttcttccacaagctcgtggccgacctcgtcgccgagatgggcgcc
gcctatccggagctgaaggaagccgagccgcgcgtgaccgacgtgctgcgccaggaggag
gagcgcttcttcgagacgatcgagcacgggatgtcgattctcgaggcggcgctcgccgaa
ctggacgccgcgggcggcaagacgctcgacggcgagctcgcgttcaagctgcacgacacg
tacggcttcccgctcgatctgacggccgacgtgtgccgcgagcgcggcgtgacggtcgac
gagccggcgttcgacgacgcgatggcgcgccagcgcgagcaggcgcgcgcggcgggcaag
ttcaaggcgacgcagggcctcgaatacacgggcgcgaagacgacgttccacggctatgag
gaaatcgcgttcgacgacgcgaaggtcgttgcgctgtacgtcgaaggcgcgtcggtcggc
gaagtgaaggcgggcgagagcgcggtggtggtgctcgaccacacgccgttctacgcggaa
tcgggtggccaggtcggcgaccagggcgtgctcgcgaacgcggccacgcgttttgcggtc
ggcgatacgctgaaggtccaggccgacgtgatcggccaccacggcgagctcgagcagggc
acgctgaaggtgggcgacgtggtccgcgcggagatcgacgccgcgcgccgcgcgcgcacc
gcgcgcaaccactcggcgacgcacctgatgcacaaggcgctgcgcgacgtgctcggctcg
cacgtgcagcagaagggctcgctcgtcgacgcggacaagacccgcttcgacttcgcgcac
aacgcgccgctgaccgacgacgaaattcgccgcgtcgaggccatcgtcaacgagcaggtg
cttgcgaacgcgccgggcatcgtgcgcgtgatgccgtacgacgacgcggtgaagggcggc
gcgatggcgctcttcggcgagaagtacggcgacgaggtgcgcgtgctcgatctcggcttc
tcgcgcgagctgtgcggcggcacgcacgtgcaccgcacgggcgacatcggcctgttcaag
atcgtcgcggaaggcggcgtcgcggcgggcattcgccgcgtcgaggcgatcacgggcgat
aacgcggtgcgctatgtgcaggcgctcgacgcgcgcgtgaacgcggcggccgccgcgctg
aaggcgcagccgtccgagctgctgcagcgcatcggccaggtgcaggatcaggtcaagtcg
ctcgagaaggagctgggcgcgctgaagtcgaagctcgcgtcgagccagggcgacgagctc
gcgcagcaggcggtcgaagtgggcggcgtgcacgtgcttgccgcgacgctcgacggcgcc
gatgcgaagacgctgcgcgaaaccgtcgacaagctgaaggacaagctcaagagcgcggcg
atcgtgctcgcggcggtcgacggcggcaaggtgagcctgatcgccggcgtcacggcggat
gcaagcaagaaagtgaaggcgggcgagctcgtgaacttcgtcgcgcagcaggtgggcggc
aagggcggcggccggccggacatggcgcaggcgggcggcacggagccggcgaagctgccg
gcggcgctcgcgggcgtcaagggctgggtcgaggcgcggctgtaa

DBGET integrated database retrieval system