KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1956Help
Entry
BURPS1106A_1956   CDS       T00480                                 

Definition
magnesium chelatase subunit ChII (EC:4.99.1.-)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS1106A_1956
Enzymes [BR:bpl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BURPS1106A_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1924471..1925808
Genome map
AA seq 445 aa AA seqDB search
MPGAAGASDATAITTGTELNPTIEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLV
AVDPGLGGVLVSGPRGTAKSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADN
TVRFSPGLVARAHLGVLYVDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALV
GTMNPEEGELRPQLLDRFGLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAA
LVAQIRAARAALPALAFDDAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARVA
AAHVERVAADVLRHRRTRFEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPGGR
ADPGEAEATRAPTPRDALPGGASGPAHPAARAPSDAQRRAADERGAARDGGRGPAADDSD
WGYLPPEPAGIAPVKGVIPLPLKKR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgccgggcgcggcaggcgcatccgatgcaaccgccatcaccacgggaactgaattgaac
ccaacgatcgaagccggcgcggcaacggccgccgcctccgacgaccgcgcattgccggcc
gcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctgctgctcgtc
gccgtcgatccgggcctgggcggcgtgctcgtgagcggtccgcgcggcaccgcgaaatcg
accgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacgctgccgctg
tcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctcgccgacaat
acggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctgtacgtcgac
gagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggccgcgagcggc
gtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttcgcgctcgtc
ggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgtttcgggctg
atggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtcaaggcgcgg
ctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcgcaggcggcg
ctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttcgacgacgcc
gcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctgcgcggcgac
ctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcgcgcgtcgcc
gcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacgcggttcgag
ccgcaacctgaatttcagcccggatttcaacccgggtctcaagccggacctcagccgatg
gggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccgggcgggcgc
gcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcgctgcccggc
ggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcagcggcgcgcg
gcggacgagcgcggcgcggcgcgcgacggcggccgtgggccggccgccgacgatagcgac
tggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtgatcccgctg
ccgctaaaaaaacgctga

DBGET integrated database retrieval system