KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2115Help
Entry
BURPS1106A_2115   CDS       T00480                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bpl00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:2107171..2109138
Genome map
AA seq 655 aa AA seqDB search
MANSKENTEAAAAPQDARRRRFLASSAVAGLAGASLSLGLAGCNKGGDAPASASGAGASA
ASGAGAAPAIDFGKYEVHPGKLDTYYTFSSGGHSGDIRVHGLPSGREIRRIPVYNIDCMS
GWGITNESRKIIGTKANGQLEYFTGDTHHVHMSYTDGTYDGKYIFVNDKINARIARVRLD
TMECDAITPLPNVQGFHGIFPDKRDPLDQTINYTTRVFCGNEFHIPHPNDGRDLNDPKKY
YCLFTCVDAKTMQPRWQVKIDGNMDLVATSYDGKLACSNQYNTENGVHYEEMMAAERDAC
VFFNVARIEEAVKNGKFFKVGNSPVPVVDGTRAANADPKTALTCYVSVPKNPHGVNASPD
GKYYACSGKLSPTATLISHELMLKWFAGELKEPRDAVVAEPEIGLGPLHTGFDGKGYAYT
TLFLDSQIVKWSLEEAIKAYKGEKAAKVVVDRIDVHYQPGHGFTSMGETKEPDGQFFISD
NKFSKDRYLPVGPLHPDSAQLIDISGEKMLLVADHPTYPEPHDSIVVRRDIIKTRQIYNL
DEFPLAVKNAKDSRVERHGRKVTVYLTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLT
HGFAIPFYNINFVVHPQQTQSVTFIADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggctaattcgaaggaaaacaccgaagcggcggcagcgccgcaggacgcgcggcggcgc
aggttcctcgcctcgtcggcggtcgcggggctcgcgggcgcgagcctgtcgctcggcctc
gcgggctgcaacaagggcggcgacgcgcccgcctcggcgagcggcgcgggcgcgagcgcg
gcgagcggcgcgggtgcggcccccgcaatcgacttcggcaagtacgaagtgcatccgggc
aagctcgatacgtactacacgttctcgagcggcggccattcgggcgacatccgcgtgcac
ggcctgccgtccgggcgcgagatccggcgcattcccgtctacaacatcgactgcatgtcc
ggctggggcatcacgaacgaatcgcgcaagatcatcggcaccaaggccaacggccagctc
gaatacttcacgggcgacacgcaccacgtgcacatgtcctatacggacggcacgtacgac
ggcaagtacatcttcgtgaacgacaagatcaatgcgcgcatcgcgcgcgtgcgcctcgac
acgatggagtgcgacgcgatcacgccgctaccgaacgtgcagggctttcacggcatcttc
cccgacaagcgcgatccgctcgaccagacgatcaactacacgacgcgcgtgttctgcggc
aacgagttccacattccgcacccgaacgacggccgcgacctgaacgacccgaagaagtac
tactgcctgttcacctgcgtcgacgcgaagacgatgcagccgcgctggcaggtgaagatc
gacggcaacatggatctcgtcgcgacgtcgtatgacggcaagctcgcgtgctcgaaccag
tacaacaccgagaacggcgtgcattacgaggaaatgatggcggccgagcgcgacgcgtgc
gtgttcttcaacgtcgcgcgcatcgaggaagcggtgaagaacggcaagttcttcaaggtg
ggcaactcgcccgtgcccgtcgtcgacggcacgcgcgcggcgaacgccgatccgaagacg
gccctcacctgctacgtgagcgtgccgaagaacccgcacggcgtgaacgcgtcgcccgac
ggcaagtactacgcgtgctcgggcaagctctcgcccaccgcgacgctgatctcgcacgag
ctgatgctcaagtggttcgcgggcgagctcaaggagccgcgcgacgcggtggtcgcggag
ccggagatcggcctcgggccgctgcataccggcttcgacggcaagggctacgcgtacacg
acgctctttctcgacagccagatcgtcaagtggagcctcgaggaagcgatcaaggcgtac
aagggcgagaaggcggcgaaagtcgtcgtcgaccggatcgacgtgcactaccagccgggc
cacggcttcacgtcgatgggcgagacgaaggagccggacggccagttcttcatctcggac
aacaagttctcgaaggaccgctacctgcccgtcgggccgctgcatccggacagcgcgcag
ttgatcgacatcagcggcgagaagatgctgctcgtggccgaccatccgacgtatcccgag
ccgcacgactcgatcgtcgtgcgccgcgacatcatcaagacacggcagatctacaacctc
gacgagttcccgctcgcggtgaagaacgcgaaggacagccgcgtcgagcggcacggcagg
aaggtcaccgtctacctgacgtcgcaggcgccgaccttcgggctgcgcgaatggaccgtg
aagaaaggcgacgaggtcacgatcatcctgaccaacctcgacaaggtggaggacctgacg
cacggcttcgcgatcccgttctacaacatcaacttcgtcgtgcatccgcagcagacgcag
tcggtgacgttcatcgcggacaagcccggcgtgttctggtgcttctgcacgaacttctgc
cacgcgctgcatctggagatgcgctcgcggatgctcgtcgaggcgtag

DBGET integrated database retrieval system