KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2332Help
Entry
BURPS1106A_2332   CDS       T00480                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(2306653..2307291)
Genome map
AA seq 212 aa AA seqDB search
MQRTDDVLLVIDVQNDFMPGGALAVAHGDEVVPAINRLAARFDHVVLTQDWHPRDHVSFA
ANHPGRAPFSTLALPYGEQVLWPVHCVQGTHGAALHGDLDIPHARLVVRKGHRASVDSYS
AFVEADRRTPTGLAGYLREIGAKRVWCCGLATDYCVAWSALDARAAGFDAAVIEDACRAI
DLDGSLARAWASLAAAGVARVQSAEVCPGVDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaccgacgatgtccttctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtcgcgcacggcgacgaagtcgtgccggcgatcaaccggctcgccgcg
cgcttcgatcacgtcgtgctgacgcaggattggcatccgcgcgatcacgtgtcgttcgcg
gcgaaccatccgggccgcgcgccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtccactgcgtgcagggcacgcacggcgcggcgctgcacggcgatctcgac
atcccgcacgcgcggctcgtggtccgcaaggggcatcgcgcgtcggtcgacagctactcg
gcgttcgtcgaggccgaccgccgcacgccgaccgggcttgccggctatctgcgcgaaatc
ggcgccaagcgcgtgtggtgctgcgggctcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcgcgcgccgcgggcttcgacgcggccgtgatcgaggacgcgtgccgcgcgatc
gatctcgacggctcgctcgcgcgcgcatgggcgtcgctcgccgcggcgggcgtcgcgcgc
gtgcagtcggccgaggtttgcccgggcgtcgatccgtag

DBGET integrated database retrieval system