KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2524Help
Entry
BURPS1106A_2524   CDS       T00480                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1106A_2524 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS1106A_2524 (aceA)
Enzymes [BR:bpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BURPS1106A_2524 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2482622..2483929
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQKQWETDPRWKGIKRAFTAEDVVRLRGSIQQEHTLAKRGAEKLWTLINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLTAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPYLTGERTVEGFFRTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGQKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcaacaacaggctcaggaactgcaaaagcaatgggaaaccgacccgcgctgg
aagggcatcaagcgcgcgttcaccgctgaggacgtcgtgcgcctgcgcggctcgatccag
caagagcacacgctcgcgaagcgcggcgcggaaaagctctggacgctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtcgcgggcgacgcgaacgtcgcgggc
gaaatgtatccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgatcagatccagtggtcggaaggcaagaaccccggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcgggcgcgtcgggcgtt
cacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaggcggtcgcgaagctgacggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgccgaagcggccgacctgatcacgtcc
gacatcgacgacaacgacaagccgtacctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgagcaggcgatctcgcgcggcctcgcctatgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctacgcccgcacgcagatgagcgcgttcgtcgaactgcagcaagcc
gagttcgcggcggccgacaagggcttcaccgcggtcaagcaccagcgtgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgacgaccgcgctgcac
ggctcgaccgaagacgaacagttcttcgacggccagaaagtcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system