KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2835Help
Entry
BURPS1106A_2835   CDS       T00480                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1106A_2835
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BURPS1106A_2835
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS1106A_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2790070..2791098)
Genome map
AA seq 342 aa AA seqDB search
MKLSPGPVMLDVAGTTLTRDDARRLAHPHTGGVILFARHFESRAQLVALTEAIRAIRDGI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKAATALGYVLASELRACGID
MSFTPVLDLDYGRSKVIGDRAFHRDPRVVALLAKSVNHGLALAGMANCGKHFPGHGFAQA
DSHVALPTDDRPLDEILANDAAPYDWLGLSLSAVIPAHVIYTQVDSKPAGFSRVWLQDVL
RGRLRFAGAVFSDDLSMEAAREGGTLAQSAQAALEAGCDMVLVCNQPDAAERVLDELRTT
ASRESSRRIKQMRPRGKALEWRKLMREPRYLNAQGLLRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcccccggtccggtgatgctcgacgtcgccggcacgacgctcacgcgcgac
gacgcgcgccgcctcgcgcatccgcacacgggcggcgtgatcctgttcgcgcgccacttc
gagagccgcgcgcaactcgtcgcgctgaccgaggcgatccgggcgatccgcgacggcatc
ctgatcgcggtcgatcacgagggcggccgcgtgcagcgctttcgcaccgacggcttcacc
gtgctgccggcgatgcgccggctcggcgagctgtgggacaaggacgtgctgcacgcgacg
aaggcggcgaccgcgctcggctatgtgctcgcttccgagctgcgcgcgtgcggcatcgac
atgagcttcacgcccgtgctcgatctcgattacggccgctcgaaggtgatcggcgatcgc
gcgttccatcgcgatccgcgcgtcgtcgcgttgctcgcgaagagcgtcaaccacgggctc
gcgctcgccgggatggcgaactgcggcaagcattttcccggccacggcttcgcgcaggcc
gattcgcacgtcgcgctgccgaccgacgatcgtccgctcgacgagatcctcgcgaacgac
gcggcgccgtacgactggctcgggctgtcgttgtcggccgttatcccggcgcacgtgatc
tacacgcaggtcgattcgaagccggccggcttctcgcgcgtgtggttgcaggacgtgctg
cgcggccggctgcgctttgcgggcgccgtgttcagcgacgatctgtcgatggaggccgcg
cgcgagggcggcacgctcgcgcagtcggcgcaggccgcgctcgaggcgggctgcgacatg
gtgctcgtgtgcaaccagccggatgcggcggagcgggtgctcgacgagctgcgcacgacg
gcgtcgcgcgaatcgtcgcggcggatcaagcagatgcggccgcgcggcaaggcgctcgag
tggcgcaagctgatgcgcgagccgcgctatctgaatgcgcagggcctgttgcgcagcacg
ttcgcctga

DBGET integrated database retrieval system