KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3015Help
Entry
BURPS1106A_3015   CDS       T00480                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(2951169..2951852)
Genome map
AA seq 227 aa AA seqDB search
MTDSNRDGAAAHSLHAGVYPGNLFMVVAPSGAGKSTLVNALLSKDPEIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRERHARHEFLESAEVHGNYYGTSRVWIEEQMKIGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHAAEAQY
VVINETFEHALAELECIVAATRLRFTSQYARHAELFVELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaccgcgacggcgcagccgcgcattcgctgcacgccggcgtctatccc
ggcaatctcttcatggtcgtcgcgccgtcgggcgcgggcaagtcgacgctcgtcaacgcg
ctgctgtcgaaggacccggagattcgcctgtcgatttcgtacacgacgcgcaagccgcgc
cccggcgaacaggacggccagcactatcacttcacgaccgtcgaggatttccgcgagcgc
catgcgcgccacgagtttctcgaaagcgccgaggtgcacggcaattactacggcacgtcg
cgcgtgtggatcgaagagcagatgaagatcggccacgacgtgctgctcgaaatcgattgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgcggcgctcgaagagcggctcaagaagcgcgggcaggacgagccgaacgtg
atcacgcggcgcctgctcgccgcgggcagcgagatcgcgcacgcggcggaagcgcagtac
gtcgtcatcaacgagaccttcgagcacgcgctcgccgagctcgagtgcatcgtcgcggcg
acgcgcctgcgcttcacgtcgcaatatgcgcggcatgccgaactattcgtcgagctcggc
attcatctgccgcacgcggagtga

DBGET integrated database retrieval system