KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3015Help
Entry
BURPS1106A_3015   CDS       T00480                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00230  Purine metabolism
bpl01100  Metabolic pathways
Module
bpl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BURPS1106A_3015 (gmk)
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BURPS1106A_3015 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 AAA_18 AAA_16 AAA_29 Septin AAA_23 Dynamin_N cobW Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABN89112
UniProt: A3NY35
Position
I:complement(2951169..2951852)
Genome map
AA seq 227 aa AA seqDB search
MTDSNRDGAAAHSLHAGVYPGNLFMVVAPSGAGKSTLVNALLSKDPEIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRERHARHEFLESAEVHGNYYGTSRVWIEEQMKIGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHAAEAQY
VVINETFEHALAELECIVAATRLRFTSQYARHAELFVELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaccgcgacggcgcagccgcgcattcgctgcacgccggcgtctatccc
ggcaatctcttcatggtcgtcgcgccgtcgggcgcgggcaagtcgacgctcgtcaacgcg
ctgctgtcgaaggacccggagattcgcctgtcgatttcgtacacgacgcgcaagccgcgc
cccggcgaacaggacggccagcactatcacttcacgaccgtcgaggatttccgcgagcgc
catgcgcgccacgagtttctcgaaagcgccgaggtgcacggcaattactacggcacgtcg
cgcgtgtggatcgaagagcagatgaagatcggccacgacgtgctgctcgaaatcgattgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgcggcgctcgaagagcggctcaagaagcgcgggcaggacgagccgaacgtg
atcacgcggcgcctgctcgccgcgggcagcgagatcgcgcacgcggcggaagcgcagtac
gtcgtcatcaacgagaccttcgagcacgcgctcgccgagctcgagtgcatcgtcgcggcg
acgcgcctgcgcttcacgtcgcaatatgcgcggcatgccgaactattcgtcgagctcggc
attcatctgccgcacgcggagtga

DBGET integrated database retrieval system