KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3059Help
Entry
BURPS1106A_3059   CDS       T00480                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bpl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:2989200..2990219
Genome map
AA seq 339 aa AA seqDB search
MNTTTLSTKLNAFARLNLIDAPTPLQYLPRLSAHVGRDIHVKRDDCTPLAMGGNKLRKLE
FLAADALGQNADVLVTAGAIQSNHVRQTAALAAQLGLGCVALLENPIAAARDDYLQSGNR
LLLDLFDVRAHVVDGLDDVDRQLEAAARRLRDEGRRPYVIPIGGSNPLGALGYVRAGLEL
AQQIRAAERDFAAVVLASGSAGTHAGLAFALAHALPGLPVIGVTVSRTDAQQRPKVRHLL
DGMSGLLDVALPAGARIDLWDDYFAPRYGEPNRAGIDALRLLARTEGLLLDPVYTGKAMA
GLIDGVARGRFDGNGPVLFVHTGGAPALFAYQDACRASR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgacgctctcgacgaaactgaacgccttcgcccgcctgaacctgatcgac
gcgccgacgccgctgcagtacttgccgcgcctgtccgcgcacgtcggccgcgacatccac
gtgaagcgcgacgactgcacgccgctcgcgatgggcggtaacaagctgcgcaagctcgaa
ttcctcgccgcggacgcgctcggccaaaacgcggacgtgctggtgaccgcgggcgcgatc
cagtcgaatcacgtccggcagacggccgcgctcgccgcgcagctcggcctcggctgtgtc
gcgctgctcgaaaacccgatcgcagccgcgcgcgacgattatctgcaaagcggcaaccgg
ctgctgctcgatctgttcgacgtgcgcgcgcacgtcgtcgacgggctcgacgacgtcgac
cggcaactcgaagccgccgcgcggcggctgcgcgacgaagggcggcgcccgtacgtgatc
ccgatcggcggatcgaatccgctcggcgcgctcggctacgtgcgcgcgggcctcgagctc
gcgcagcagatccgcgcggccgagcgcgatttcgcggctgtcgtgctcgcgtccggcagc
gccggcacgcacgcgggcctcgcgttcgcgctcgcgcacgcgttgcccgggctgccggtg
atcggcgtgacggtatcgcgcaccgacgcgcagcagcgcccgaaggtgcggcatctgctc
gacggcatgagcgggctgctcgacgtcgcgttgccggcgggcgcacgcatcgatctgtgg
gacgactacttcgcgccgcgctacggcgagcccaatcgcgcgggcatcgacgcgctgcgg
ctgctcgcgcgaaccgaggggctgctgctcgatccggtgtacacgggcaaggcgatggcg
ggtctcatcgacggcgtcgcgcgcggccgcttcgacggaaacggcccggtgctgttcgtg
catacgggcggcgcgcccgcgctgttcgcgtatcaggacgcgtgccgcgcgagccgatga

DBGET integrated database retrieval system