KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3099Help
Entry
BURPS1106A_3099   CDS       T00480                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
Enzymes [BR:bpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BURPS1106A_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:3021095..3021748
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPSGQKM
LFPRVEARILQELAVKKHENVLEIGAGGGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGVTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDTQYRVADVFETYVDHLVNAIEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaatttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgagcggccagaagatg
ctgttcccgcgcgtcgaggcccgcatcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggcgcgggcggcggctacatggcggccttgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggatctcgcgaagttcgccgaagagaacctgaag
aagaacggcgtgacgaacgccgaggtcgtgctcggcgacggctcgcgcggctggcccgcg
aaggcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggaactg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacgcgcatcgacgacacgcaatatcgcgtcgccgacgtattcgag
acctacgtcgatcacctcgtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system