KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3305Help
Entry
BURPS1106A_3305   CDS       T00480                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1106A_3305 (folK)
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BURPS1106A_3305 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:3223182..3223709
Genome map
AA seq 175 aa AA seqDB search
MTVAYLGLGANLGDARQALKDAVVCLAQQHAITVLGKSSLYRTAPVDASGGDYYNCVVKI
DTVLAARTLLALCQKIEHHFGRERPYRNAPRTLDIDILLYGELTIDEPDLVVPHPRLTER
AFALVPLVEIEPALAIPARGRADGFLADVAHQRIEKVQTCQCLAMRAAAEKNRCR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcgggttgggggccaatctcggcgacgcgcgccaggccttgaag
gacgcagtggtctgcctcgcccagcagcacgccatcacggtgctcggcaagtcgagcctg
tatcgcaccgcgcccgtcgacgcgagtggcggcgattactacaactgcgtcgtgaagatc
gacacggtgctcgccgcgcgcacgctcctcgcgctgtgccagaagatcgagcaccacttc
ggccgcgagcggccgtaccgaaacgcgccgcgcacgctcgacatcgacatcctgctctac
ggtgaactgacgatagacgaacccgacctcgtcgttccgcatccgcgcctgaccgagcgc
gcgttcgcgctcgtgccgctcgtcgagatcgagccggcgctcgcgattcccgcacgcggc
cgcgccgacggattcctcgccgacgtcgcgcaccagcgcatcgagaaggtccagacctgc
cagtgcctcgcgatgcgggccgccgccgaaaagaaccgttgccgatga

DBGET integrated database retrieval system