KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3464Help
Entry
BURPS1106A_3464   CDS       T00480                                 

Gene name
cynS
Definition
cyanate hydratase (EC:4.2.1.104)
Orthology
K01725  
cyanate lyase [EC:4.2.1.104]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BURPS1106A_3464 (cynS)
Enzymes [BR:bpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.104  cyanase
     BURPS1106A_3464 (cynS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3371507..3371977
Genome map
AA seq 156 aa AA seqDB search
MTQSQHSQSAREALAERIVEAKTRKNLTFEQINEGTGLSVAFTTAALLGQHPLPADAARV
VAAKLDLDDDAQRLLQTIPVRGSIPGGVPTDPTIYRFYEIVQVYGSTLKALIHEQFGDGI
VSAINFKLDIKKVDDPEGGSRAVITLDGKYLPTKPF
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcgcaacacagccaatccgcgcgcgaggcgctcgccgagcgcatcgtcgaa
gccaagacccgcaagaacctcacattcgagcagatcaacgaaggcaccggcctgagcgtc
gcgttcacgacggccgcgctgctcggccagcatccgctgcccgccgacgccgcgcgcgtc
gtcgccgcgaagctcgatctcgacgacgatgcacagcgcctgctgcagacgatccccgtg
cgcggcagcatcccgggcggcgtcccgaccgatccgacgatctaccgcttctacgaaatc
gtgcaggtgtacggctcgacgctgaaggcgctgattcacgagcaattcggcgacggcatc
gtcagcgcgatcaatttcaagctcgatatcaagaaggtcgacgatccggagggcggctcg
cgcgccgtcatcacgctcgacggcaagtatctgccgacgaagccgttctga

DBGET integrated database retrieval system