KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3464Help
Entry
BURPS1106A_3464   CDS       T00480                                 

Gene name
cynS
Definition
cyanate hydratase (EC:4.2.1.104)
Orthology
K01725  
cyanate lyase [EC:4.2.1.104]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bpl00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:3371507..3371977
Genome map
AA seq 156 aa AA seqDB search
MTQSQHSQSAREALAERIVEAKTRKNLTFEQINEGTGLSVAFTTAALLGQHPLPADAARV
VAAKLDLDDDAQRLLQTIPVRGSIPGGVPTDPTIYRFYEIVQVYGSTLKALIHEQFGDGI
VSAINFKLDIKKVDDPEGGSRAVITLDGKYLPTKPF
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcgcaacacagccaatccgcgcgcgaggcgctcgccgagcgcatcgtcgaa
gccaagacccgcaagaacctcacattcgagcagatcaacgaaggcaccggcctgagcgtc
gcgttcacgacggccgcgctgctcggccagcatccgctgcccgccgacgccgcgcgcgtc
gtcgccgcgaagctcgatctcgacgacgatgcacagcgcctgctgcagacgatccccgtg
cgcggcagcatcccgggcggcgtcccgaccgatccgacgatctaccgcttctacgaaatc
gtgcaggtgtacggctcgacgctgaaggcgctgattcacgagcaattcggcgacggcatc
gtcagcgcgatcaatttcaagctcgatatcaagaaggtcgacgatccggagggcggctcg
cgcgccgtcatcacgctcgacggcaagtatctgccgacgaagccgttctga

DBGET integrated database retrieval system