KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3523Help
Entry
BURPS1106A_3523   CDS       T00480                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3427825..3429009)
Genome map
AA seq 394 aa AA seqDB search
MKPGGAAGVRDSIAHHSRRQRTMRSIIADSKRLVVKVGSSLVTNDGRGLDHDAIGRWAAQ
IAALRGAGKEVVLVSSGAIAEGMQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFAEH
GIRTAQILLTHADLADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGA
LVANLIEGDTLVILTDQPGLFTADPRKDPGATLVAEASAGAPELEAMAGGAGSSIGRGGM
LTKILAAKRAAHSGANTVIASGRERDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQ
VRGHVVIDAGAVDKLTAGGKSLLPIGVVAVQGVFARGEVIACVDDTGREVARGITNYSSA
ETKLIQRKPSGEIETVLGYMLEPELIHRDNLVLV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgggcggcgcggccggcgtacgggattcaatcgcgcatcactcaaggagacag
cgcacgatgcgttcgatcatcgccgattcgaagcgcctggtagtgaaagtgggctcgagc
ctcgtcaccaacgacggccgcgggctcgatcatgacgccatcggccgatgggccgcccag
atcgccgcgctgcgcggcgcgggcaaggaagtggtgctcgtcagctcgggcgcgatcgcg
gaaggcatgcagcgcctcggttggagcaagcggccgcgcgagatcgacgagttgcaagcg
gccgcggccgtcgggcaaatggggctcgcgcaggtatacgagagccggtttgccgaacac
gggatccgcaccgcgcagattctcctcacgcatgcggatctcgccgaccgcgaacgctac
ctgaacgcgcgctcgacgctcctcacgctgctgcggctcggcgtcgtgccgatcatcaac
gagaacgacaccgtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcg
ctcgtcgcgaatctgatcgaaggcgatacgctcgtcatcctgaccgaccagccggggctg
ttcacggccgatccgcgcaaggatccgggcgcgacgctcgttgccgaggcgagcgccggt
gcgccggagctcgaagcgatggcgggcggcgcgggctcgagcatcggccgcggcggcatg
ctgacgaagattctcgcggccaagcgcgccgcgcacagcggcgcgaacaccgtgatcgcg
agcggccgcgagcgcgacgtgctcgtgcggctcgcggccggcgaggcgatcggcacgcaa
ctgatcgcgcgcaccgcgcggatggcggcgcgcaagcaatggatggcggaccacctgcag
gtacgtggccatgtcgttatcgatgcgggggcggtcgacaagttgacggcggggggcaag
agcctgttgccgatcggcgtcgtcgccgtgcagggcgtgttcgcgcgcggcgaagtgatc
gcgtgcgtcgacgacaccggccgtgaagtcgcgcgcgggatcaccaattacagcagcgcc
gaaacgaagctgatccagcgcaagccgagcggcgagatcgaaacggtgctcggctacatg
ctcgagcccgagctgatccatcgggacaatctcgtgctggtctga

DBGET integrated database retrieval system