KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3555Help
Entry
BURPS1106A_3555   CDS       T00480                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3460422..3461966)
Genome map
AA seq 514 aa AA seqDB search
MSAARSSHPAHQQIAAALAWLRTHVVPGAQLHADTRSLRAGDVFVAYAVDGADNRPFIAD
ALARGAAAVLYQPEGFPAEGLDSATSLAVPALDALAGDIASGWYGDPSDAMFSVGVTGTN
GKTSCTQWIAAALTALREPCAVIGTLGSGMPGQLVHTGFTTPDAPQLQRSLAQLRDAGAR
AVAMEVSSHALHQGRVNGTAFDVAVFTNLTQDHLDYHRTFEAYEAAKAKLFAWRGLRCAV
VNRDDPAGRRLLANLTGRVRTIAYGIDSPTQAADADRELVATNVRATATGTAFRVTSAWG
EADVEVGTLGAFNVSNLLAVLGTLLAADVPFDAALAEIGKLESVNGRMQRLGGRLQNDEP
LVVVDYAHTPDALEKTLDALRPIAQARGGELICMFGCGGDRDATKRPLMGAIAERLADKV
VVTSDNPRSEDPQKIIDQIVAGMRDASGARRVEDRASAILQAVRGAAREDVVLLAGKGHE
ATQEIMGKKRAFSDQDHARLALAARTTQTRGGGE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgcgcagttctcatccggcgcaccaacagatcgcagccgcgctcgcgtgg
ctgcgcacgcatgtcgtgcccggcgcgcagttacacgccgacacgcgcagcctgcgggcg
ggcgacgtgttcgtcgcctatgcggtcgacggcgcggacaatcgtccgttcatcgccgat
gcgctcgcgcgcggcgcggccgccgtgctgtatcagcccgaagggttcccggccgaaggg
ctcgactccgcgacgtcgctcgccgtgcccgcgctcgacgcgctcgcgggcgacatcgcg
agcggctggtacggcgacccgagcgatgcgatgttctcggtcggcgtgaccggcacgaac
ggcaagacgtcgtgcacgcaatggatcgccgccgcgctcaccgcgctgcgcgagccgtgc
gcggtgatcggcacgctcggcagcgggatgcccggccagctcgtgcacaccggcttcacg
acgcccgacgcgccgcaactgcagcgcagcctcgcgcaactgcgcgatgcgggcgcgcgg
gcggtcgcgatggaagtttcgtcgcacgcgctgcatcaagggcgcgtgaacggcaccgcg
ttcgacgtcgcggtgttcacgaacctcacgcaggatcacctcgattaccaccgcacgttc
gaagcctacgaggcggcgaaggcgaagctcttcgcctggcgcgggctgcgctgcgcggtc
gtcaaccgcgacgatccggcaggccgccgcctgctcgcgaatctcaccgggcgcgtgcga
acgatcgcgtacggcatcgattcgccgacgcaggcggccgacgcggatcgcgagctcgtc
gcgacgaacgttcgcgcgaccgcgacgggcaccgcgtttcgcgtgacgtcagcgtggggc
gaagcggacgtcgaggtcggcacgctcggcgcgttcaacgtgagcaatctgctcgcggtg
ctcggcacgctgctcgcggccgacgtgccgttcgacgcggcgctcgccgaaatcggcaag
ctcgaatcggtcaacggccggatgcagcgattgggtgggcggctgcagaacgacgagccg
ctcgtcgtcgtcgattacgcgcacacgccggacgcgctcgagaagacgctcgacgcgctg
cgcccgatcgcacaggcgcgcggcggcgagctcatctgtatgttcggctgcggcggcgac
cgcgatgcgaccaagcgcccgctgatgggcgcgatcgccgagcggctcgcggacaaggtc
gtcgtgacgagcgacaacccgcgcagcgaggatccgcagaagatcatcgaccagatcgtc
gccggcatgcgggatgcctcgggcgcgcgccgtgtcgaggatcgcgcgagcgcgatcctg
caggcggtgcgcggtgcggcgcgcgaagacgtcgtgctgctcgccggcaagggccatgag
gcgacgcaggaaatcatgggcaagaagcgcgcgttctccgatcaggaccacgcgcgcctc
gcgctcgccgcgcgcacgacgcagactcgcggaggcggcgaatga

DBGET integrated database retrieval system