KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3591Help
Entry
BURPS1106A_3591   CDS       T00480                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
Enzymes [BR:bpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BURPS1106A_3591
Secretion system [BR:bpl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BURPS1106A_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3498991..3499719)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEV
NLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKSWQS
WMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaatcgcgcctc
ggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttgtacgaggtc
aatctcggttcgcagatcgtctatagcgacgcatcgggcgattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgagatcaacaag
atcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagctggcagtcg
tggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgaccgcgctcgac
aagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgtattcctcgcc
gacggcacgcgcctgccgggcgccgtatccgcggacgaactgaatcaggcgctcgccggc
gtcaagtga

DBGET integrated database retrieval system