KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3774Help
Entry
BURPS1106A_3774   CDS       T00480                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
I:3687318..3688406
Genome map
AA seq 362 aa AA seqDB search
MLDRYHIPLSQKFTEGNCKVSSVTYPSHSAMSIHPLHRPRRMRRDDFSRRLMRENILTTN
DLIYPVFVVEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVELGVPVLSLFPAIEPSLKTP
DGREAANPEGLIPRAVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEAGYVLNDETLEI
LVEQARAQAEAGVDIVAPSDMMDGRIGAVREMLEREGHIYTRIMAYSAKYASAFYGPFRD
AVGSASNLGKGNKMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEF
RYPTYVYQVSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRAGADGILTYFALDAARLLRA
QK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgatcgctatcatataccattgtctcaaaagtttaccgaagggaactgtaaggtt
tcgtcggttacctatcccagccattccgccatgagcatccatcccctgcaccgcccgcgc
cgcatgcgccgcgacgatttctcgcgacgcctgatgcgcgaaaatatcctcaccacgaac
gatctgatctacccggtgttcgtcgtcgaaggcacgaacgtgcgccagccggtgccgtcg
atgccgggcgtcgagcgcgtgtcgatcgatctgctgatgggtgtcgccgagcaatgcgtc
gagctcggcgtgccggtcctgtcgctctttccggccatcgagccgtcgctgaagacgccc
gacggccgcgaagcggccaatcccgaagggctgatcccgcgtgcggtacgcgagctgaag
cgccgcttccccgaactcggcgtgctgaccgacgtcgcgctcgatccgtacacgagccac
ggccaggacggcgtgctcgacgaggccggctatgtgctcaacgacgaaacgctcgagatt
ctcgtcgagcaggcgcgcgcgcaggccgaagcgggtgtcgacatcgtcgcgccgtcggac
atgatggacgggcgcatcggcgcggtgcgcgagatgctcgagcgtgaaggccacatctac
acgcggatcatggcctactcggcgaagtacgcgtcggcgttctacggcccgttccgcgac
gcggtcggctccgcgtcgaatctcggcaagggcaacaagatgacctaccagatggacccc
gcgaacagcgacgaggcgctgcgcgaagtgcgcctcgacatcgacgagggcgcggacatg
gtcatggtgaagcccggcatgccgtatctcgacatcgtgcgccgcgtgaaggacgaattc
cgctatccgacctacgtctatcaggtgagcggcgaatacgcgatgctgaaggccgccgcg
cagaacggctggctcgatcacgacaaagtcgtgctcgaatcgctgctcgcgttcaagcgc
gcgggcgcggacggcattctcacgtacttcgcgctcgacgcggcgcggctgctgcgcgcg
cagaagtaa

DBGET integrated database retrieval system