KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3774Help
Entry
BURPS1106A_3774   CDS       T00480                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS1106A_3774 (hemB)
Enzymes [BR:bpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BURPS1106A_3774 (hemB)
Exosome [BR:bpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1106A_3774 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3687318..3688406
Genome map
AA seq 362 aa AA seqDB search
MLDRYHIPLSQKFTEGNCKVSSVTYPSHSAMSIHPLHRPRRMRRDDFSRRLMRENILTTN
DLIYPVFVVEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVELGVPVLSLFPAIEPSLKTP
DGREAANPEGLIPRAVRELKRRFPELGVLTDVALDPYTSHGQDGVLDEAGYVLNDETLEI
LVEQARAQAEAGVDIVAPSDMMDGRIGAVREMLEREGHIYTRIMAYSAKYASAFYGPFRD
AVGSASNLGKGNKMTYQMDPANSDEALREVRLDIDEGADMVMVKPGMPYLDIVRRVKDEF
RYPTYVYQVSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRAGADGILTYFALDAARLLRA
QK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgatcgctatcatataccattgtctcaaaagtttaccgaagggaactgtaaggtt
tcgtcggttacctatcccagccattccgccatgagcatccatcccctgcaccgcccgcgc
cgcatgcgccgcgacgatttctcgcgacgcctgatgcgcgaaaatatcctcaccacgaac
gatctgatctacccggtgttcgtcgtcgaaggcacgaacgtgcgccagccggtgccgtcg
atgccgggcgtcgagcgcgtgtcgatcgatctgctgatgggtgtcgccgagcaatgcgtc
gagctcggcgtgccggtcctgtcgctctttccggccatcgagccgtcgctgaagacgccc
gacggccgcgaagcggccaatcccgaagggctgatcccgcgtgcggtacgcgagctgaag
cgccgcttccccgaactcggcgtgctgaccgacgtcgcgctcgatccgtacacgagccac
ggccaggacggcgtgctcgacgaggccggctatgtgctcaacgacgaaacgctcgagatt
ctcgtcgagcaggcgcgcgcgcaggccgaagcgggtgtcgacatcgtcgcgccgtcggac
atgatggacgggcgcatcggcgcggtgcgcgagatgctcgagcgtgaaggccacatctac
acgcggatcatggcctactcggcgaagtacgcgtcggcgttctacggcccgttccgcgac
gcggtcggctccgcgtcgaatctcggcaagggcaacaagatgacctaccagatggacccc
gcgaacagcgacgaggcgctgcgcgaagtgcgcctcgacatcgacgagggcgcggacatg
gtcatggtgaagcccggcatgccgtatctcgacatcgtgcgccgcgtgaaggacgaattc
cgctatccgacctacgtctatcaggtgagcggcgaatacgcgatgctgaaggccgccgcg
cagaacggctggctcgatcacgacaaagtcgtgctcgaatcgctgctcgcgttcaagcgc
gcgggcgcggacggcattctcacgtacttcgcgctcgacgcggcgcggctgctgcgcgcg
cagaagtaa

DBGET integrated database retrieval system