KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0021Help
Entry
BURPS1106A_A0021  CDS       T00480                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BURPS1106A_A0021 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BURPS1106A_A0021 (bdhA)
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BURPS1106A_A0021 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(16259..17044)
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIGV
AMDVTNEDAVNAGIDKVAETFGSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFLS
AFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctgaatggcaaaaccgccatcgtgacgggcgcggcgagcggcatcggcaag
gaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaaccag
gacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcaatcggcgtg
gcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgccgagacg
ttcggctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatcgag
aactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttcctg
acgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggagtggtgatctac
atgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggccaag
cacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtgcgc
tcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccggag
caggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggccag
acggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctgtcc
gcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttcatg
caatga

DBGET integrated database retrieval system