KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0530Help
Entry
BURPS1106A_A0530  CDS       T00480                                 

Gene name
acsA
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:514130..516112
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccgggatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgcgagacgctcgaatggcgcaagccg
ttcggcaaggtgctcgacgagacgaacgcgccgttctacaagtggttcgaggacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgccgcgggcttgggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctacgctgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaagcgcggcgtcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcatgcgcgcgg
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcaccgccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtgtatcgccgcacgggcggcaatgtcgactggcacgcgggccgcgac
gtctggatgcacgagatggtcgcgaacgagtccgacgcgtgcgagcccgaatgggtcggc
gccgagcatccgctgttcatcctgtacacgtccggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctgtgggtcgcgcagacgatgaagtggacgttcgac
tggaagcccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccactcg
tatatcacgtacgggccgctcgccgtcggcgcgacgcaggtggtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggcggccgaggccgacgaccgcgtg
catccgaggagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggcgcgctgcccgatcgtc
gacacctggtggcagaccgaaacgggcggccacatgatcacgccgctaccgggcgcgacg
ccgacggtgccgggctcgtgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgcccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gaggagctcggcggccgcctgtatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgccgaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgctcaagcgc
tcgcggccggaaggcgaggaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggagatcgggccgatcgcgaagccgaaggacatccgtttcggcgataacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgttgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgatcctcgaacagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system