KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0738Help
Entry
BURPS1106A_A0738  CDS       T00480                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00625  Chloroalkane and chloroalkene degradation
bpl00680  Methane metabolism
bpl01100  Metabolic pathways
bpl01120  Microbial metabolism in diverse environments
bpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BURPS1106A_A0738 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BURPS1106A_A0738 (fdhA)
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BURPS1106A_A0738 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP ADH_N_assoc YjeF_N
Motif
Other DBs
NCBI-ProteinID: ABN93033
UniProt: A3P364
Position
II:726185..727384
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCAMCKEQHTGVCLNVNPARA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMAKIRDLTCLSDILPTGYHGAV
TAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMNAERLAHAKAMGFEVVDLSKD
ATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTPVLKYSRNLMQAILFDRLPIA
EIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaagtgcggaagatc
gactatccgaagatggtcgatccgagcggccgcgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcg
cccgtcggtctcgtgctcggccacgagatcacgggcgaggtgatcgaggtcggccgcgat
gtcgagacgctgaagatcggcgatctcgtatcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtatgcctgaacgtgaatccggcgcgcgcg
ggcggcgcgtacggctatgtcgacatgggcggctggatcggcgggcaagccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatccgcgatctcacgtgcctgtcggacatcctgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgaccgtctacgtcgcgggcgcgggcccggtggggatg
gcggccgccgcgtcggcgcggctgctcggcgccgcatgcacgatcgtcggcgacatgaac
gccgagcgcctcgcgcacgcgaaggcgatgggcttcgaggtggtcgatctgtcgaaggac
gcgacgctcggcgagcagatcgagcaaatcctcggcaagccggagatcgattgcgcggtt
gactgcgtcggcttcgaggcgcacggccacggctcgtccggccatgcgcaggaggcgccc
gcgacggtgctgaactcgctgatggaaatcacccggcccgcgggcgcgatcggcattccg
ggcctgtacgtgaccgacgatccgggcgccgtcgatgtcgccgccaagcacggcagcctg
agcattcgtttcggtctcggctgggcgaaatcgcattcgttccataccggccagacgccc
gtgctcaagtacagccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
gaaatcgtcaacgtggcggtgatttcgctcgacgacgcgccggagggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system