KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0842Help
Entry
BURPS1106A_A0842  CDS       T00480                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1106A_A0842
   00330 Arginine and proline metabolism
    BURPS1106A_A0842
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BURPS1106A_A0842
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BURPS1106A_A0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(838560..839474)
Genome map
AA seq 304 aa AA seqDB search
MDYQPILERIHTELASWIGAGRVADYIPELAKVPAERFGMAVVTLDGRIHTVGDARERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGNAFNSLVQLESERGIPRNPFINAGALIVT
DVLCRRFVGAETALVQFMRRLTGVAELDYDLRVASSELAHAERNRAMAHFMASFGNLHMP
PETVIDAYCRQCAIEMNCIELATAALFLANAGVAPVSGERILDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSVAGVQALEQLTTLTG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggattatcagccgattctcgaacgcatccacaccgaactcgcgtcctggatcggcgcg
ggccgcgtcgccgactacatccccgaactcgcgaaagtgccggccgagcggttcggcatg
gccgtcgtcacgctcgacggccgcatccacacggtcggcgacgcgcgcgaacgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagttgctcggcgatgcg
ctgtgggaacgggtcggccgagagccgtcgggcaacgcgttcaactcgctcgttcagctc
gaaagcgagcgcggcataccgcgcaatccgttcatcaatgcgggggcgctgatcgtcacc
gacgtcctgtgccgccgcttcgtcggcgccgagacggcgctcgtccagttcatgcgccgt
ctgacaggcgtcgccgagctcgactacgatctgcgcgtcgcgagctccgagctcgcccat
gccgaacgcaatcgcgcgatggcgcacttcatggcgagcttcggcaatctgcacatgccg
cccgagacggtgatcgacgcctattgccgccagtgtgcgatcgagatgaactgcatcgag
ctggcgaccgcggcgctctttctcgccaacgcgggcgttgcgcccgtatccggcgaacgc
attctcgatgccagctcggccaagcgcctgtccgccctcatgctgacatgcggcacgtac
gacgcggcaggcgatttcgtgtatcgcgtcggcctgcccgcgaaaagcggcgtgggcggc
ggcatcgtcgccgtgctgccgggcgagatggccgtgtgcgtctggtcgcccgggctcgac
gcaaacggcaactccgtcgccggcgttcaggcgctcgaacagttgaccacgctgaccggc
cggtcgattttctga

DBGET integrated database retrieval system